Western Blot (WB)
(Host: RabbitTarget Name: DCLK3Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse DCLK3 Polyclonal Antibody | anti-DCLK3 antibody
DCLK3 Antibody - C-terminal region
Gene Names
Dclk3; Dcamkl3; BC056929; C730036H08
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
DCLK3; Polyclonal Antibody; DCLK3 Antibody - C-terminal region; anti-DCLK3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MWAAGVILYILLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDA
Sequence Length
790
Applicable Applications for anti-DCLK3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse DCLK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DCLK3Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DCLK3Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DCLK3 antibody
This gene encodes a member of the protein kinase superfamily and the doublecortin family. Differently from the other two closely related family members (DCLK1 and DCLK2), the protein encoded by this gene contains only one N-terminal doublecortin domain and is unable to bind microtubules and to regulate microtubule polymerization. The protein contains a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmoduline-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions.
Product Categories/Family for anti-DCLK3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86 kDa
NCBI Official Full Name
serine/threonine-protein kinase DCLK3
NCBI Official Synonym Full Names
doublecortin-like kinase 3
NCBI Official Symbol
Dclk3
NCBI Official Synonym Symbols
Dcamkl3; BC056929; C730036H08
NCBI Protein Information
serine/threonine-protein kinase DCLK3
UniProt Protein Name
Serine/threonine-protein kinase DCLK3
Protein Family
UniProt Gene Name
Dclk3
UniProt Synonym Gene Names
Dcamkl3; CLr
UniProt Entry Name
DCLK3_MOUSE
NCBI Description
This gene encodes a member of the protein kinase superfamily and the doublecortin family. Differently from the other two closely related family members (DCLK1 and DCLK2), the protein encoded by this gene contains only one N-terminal doublecortin domain and is unable to bind microtubules and to regulate microtubule polymerization. The protein contains a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmoduline-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. [provided by RefSeq, Sep 2010]
Similar Products
Product Notes
The DCLK3 dclk3 (Catalog #AAA3223861) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCLK3 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DCLK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCLK3 dclk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MWAAGVILYI LLCGFPPFRS PERDQDELFN IIQVGQFEFL SPYWDNISDA. It is sometimes possible for the material contained within the vial of "DCLK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
