Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAMK4Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CAMK4 Polyclonal Antibody | anti-CAMK4 antibody

CAMK4 Antibody - middle region

Gene Names
CAMK4; caMK; CaMKIV; CaMK IV; CaMK-GR
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAMK4; Polyclonal Antibody; CAMK4 Antibody - middle region; anti-CAMK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQAL
Sequence Length
473
Applicable Applications for anti-CAMK4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAMK4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAMK4Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAMK4Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CAMK4 antibody
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
814
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type IV isoform 1
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase IV
NCBI Official Symbol
CAMK4
NCBI Official Synonym Symbols
caMK; CaMKIV; CaMK IV; CaMK-GR
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type IV
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type IV
UniProt Gene Name
CAMK4
UniProt Synonym Gene Names
CAMK; CAMK-GR; CAMKIV; CaMK IV
UniProt Entry Name
KCC4_HUMAN

NCBI Description

The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMK4: a protein kinase of the CAMK1 family. Implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. Two alternatively sliced isoforms have been described.

Protein type: Protein kinase, CAMK; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 5q21.3

Cellular Component: nucleoplasm; nucleolus; cytosol

Molecular Function: calmodulin binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: epidermal growth factor receptor signaling pathway; mitochondrion organization and biogenesis; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; organelle organization and biogenesis; positive regulation of transcription, DNA-dependent; regulation of T cell differentiation in the thymus; nucleocytoplasmic transport; myeloid dendritic cell differentiation; signal transduction; protein amino acid phosphorylation; positive regulation of protein export from nucleus; synaptic transmission; regulation of osteoclast differentiation; long-term memory; phospholipase C activation; innate immune response; nerve-nerve synaptic transmission; inflammatory response; myeloid dendritic cell cytokine production

Research Articles on CAMK4

Similar Products

Product Notes

The CAMK4 camk4 (Catalog #AAA3221645) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK4 camk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESHKASRDPS PIQDGNEDMK AIPEGEKIQG DGAQAAVKGA QAELMKVQAL. It is sometimes possible for the material contained within the vial of "CAMK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.