Western Blot (WB)
(Host: RabbitTarget Name: C13ORF18Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RUBCNL Polyclonal Antibody | anti-RUBCNL antibody
RUBCNL Antibody - middle region
Gene Names
RUBCNL; PACER; C13orf18; KIAA0226L
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RUBCNL; Polyclonal Antibody; RUBCNL Antibody - middle region; anti-RUBCNL antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVS
Sequence Length
527
Applicable Applications for anti-RUBCNL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C13ORF18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C13ORF18Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C13ORF18Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RUBCNL antibody
This gene encodes a cysteine-rich protein that contains a putative zinc-RING and/or ribbon domain. The encoded protein is related to Run domain Beclin-1-interacting and cysteine-rich domain-containing protein, which plays a role in endocytic trafficking and autophagy. In cervical cancer cell lines, this gene is expressed at low levels and may function as a tumor suppressor. Promoter hypermethylation of this gene is observed in cervical cancer cell lines and tissue derived from human patients.
Product Categories/Family for anti-RUBCNL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
protein RUBCNL-like isoform a
NCBI Official Synonym Full Names
rubicon like autophagy enhancer
NCBI Official Symbol
RUBCNL
NCBI Official Synonym Symbols
PACER; C13orf18; KIAA0226L
NCBI Protein Information
protein RUBCNL-like
UniProt Protein Name
Uncharacterized protein KIAA0226-like
UniProt Gene Name
KIAA0226L
UniProt Synonym Gene Names
C13orf18
UniProt Entry Name
K226L_HUMAN
NCBI Description
This gene encodes a cysteine-rich protein that contains a putative zinc-RING and/or ribbon domain. The encoded protein is related to Run domain Beclin-1-interacting and cysteine-rich domain-containing protein, which plays a role in endocytic trafficking and autophagy. In cervical cancer cell lines, this gene is expressed at low levels and may function as a tumor suppressor. Promoter hypermethylation of this gene is observed in cervical cancer cell lines and tissue derived from human patients. [provided by RefSeq, Mar 2017]
Uniprot Description
KIAA0226L: 5 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 13q14.13
Research Articles on RUBCNL
Similar Products
Product Notes
The RUBCNL kiaa0226l (Catalog #AAA3222271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUBCNL Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RUBCNL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RUBCNL kiaa0226l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TESWSKEVSG LLGSDQPDSE MTFDTNIKQE SGSSTSSYSG YEGCAVLQVS. It is sometimes possible for the material contained within the vial of "RUBCNL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
