Western Blot (WB)
(Host: RabbitTarget Name: HS3ST3B1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Rabbit HS3ST3B1 Polyclonal Antibody | anti-HS3ST3B1 antibody
HS3ST3B1 antibody - N-terminal region
Gene Names
HS3ST3B1; 3OST3B1; 3-OST-3B; h3-OST-3B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HS3ST3B1; Polyclonal Antibody; HS3ST3B1 antibody - N-terminal region; anti-HS3ST3B1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
Sequence Length
390
Applicable Applications for anti-HS3ST3B1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 87%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HS3ST3B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HS3ST3B1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HS3ST3B1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-HS3ST3B1 antibody
This is a rabbit polyclonal antibody against HS3ST3B1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.
Target Description: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.
Product Categories/Family for anti-HS3ST3B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
heparan sulfate glucosamine 3-O-sulfotransferase 3B1
NCBI Official Synonym Full Names
heparan sulfate-glucosamine 3-sulfotransferase 3B1
NCBI Official Symbol
HS3ST3B1
NCBI Official Synonym Symbols
3OST3B1; 3-OST-3B; h3-OST-3B
NCBI Protein Information
heparan sulfate glucosamine 3-O-sulfotransferase 3B1
UniProt Protein Name
Heparan sulfate glucosamine 3-O-sulfotransferase 3B1
Protein Family
UniProt Gene Name
HS3ST3B1
UniProt Synonym Gene Names
3OST3B1; HS3ST3B; 3-OST-3B; Heparan sulfate 3-O-sulfotransferase 3B1; h3-OST-3B
UniProt Entry Name
HS3SB_HUMAN
NCBI Description
The protein encoded by this gene is a type II integral membrane protein that belongs to the 3-O-sulfotransferases family. These proteins catalyze the addition of sulfate groups at the 3-OH position of glucosamine in heparan sulfate. The substrate specificity of individual members of the family is based on prior modification of the heparan sulfate chain, thus allowing different members of the family to generate binding sites for different proteins on the same heparan sulfate chain. Following treatment with a histone deacetylase inhibitor, expression of this gene is activated in a pancreatic cell line. The increased expression results in promotion of the epithelial-mesenchymal transition. In addition, the modification catalyzed by this protein allows herpes simplex virus membrane fusion and penetration. A very closely related homolog with an almost identical sulfotransferase domain maps less than 1 Mb away. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Research Articles on HS3ST3B1
Similar Products
Product Notes
The HS3ST3B1 hs3st3b1 (Catalog #AAA3208286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS3ST3B1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HS3ST3B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HS3ST3B1 hs3st3b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMLCVWLYMF LYSCAGSCAA APGLLLLGSG SRAAHDPPAL ATAPDGTPPR. It is sometimes possible for the material contained within the vial of "HS3ST3B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
