Rabbit anti-Human EHD2 Polyclonal Antibody | anti-EHD2 antibody

EHD2 Antibody - middle region

Cat. Num. AAA3220651

• Gene Names: EHD2; PAST2
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: EHD2; Polyclonal Antibody; EHD2 Antibody - middle region; anti-EHD2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
• Sequence: Synthetic peptide located within the following region: HMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKL
• Sequence Length: 543

• Applicable Applications for anti-EHD2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EHD2Sample Tissue: HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-EHD2 antibody

This gene encodes a member of the EH domain-containing protein family. These proteins are characterized by a C-terminal EF-hand domain, a nucleotide-binding consensus site at the N terminus and a bipartite nuclear localization signal. The encoded protein interacts with the actin cytoskeleton through an N-terminal domain and also binds to an EH domain-binding protein through the C-terminal EH domain. This interaction appears to connect clathrin-dependent endocytosis to actin, suggesting that this gene product participates in the endocytic pathway.

Product Categories/Family for anti-EHD2 antibody

Polyclonal; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 21361462
• NCBI GeneID: 30846
• NCBI Accession #: NP_055416.2
• NCBI GenBank Nucleotide #: NM_014601.3
• UniProt Accession #: Q9NZN4
• Molecular Weight: 59 kDa
• NCBI Official Full Name: EH domain-containing protein 2
• NCBI Official Synonym Full Names: EH domain containing 2
• NCBI Official Symbol: EHD2
• NCBI Official Synonym Symbols: PAST2
• NCBI Protein Information: EH domain-containing protein 2
• UniProt Protein Name: EH domain-containing protein 2
• Protein Family: EH domain-containing protein
• UniProt Gene Name: EHD2
• UniProt Synonym Gene Names: PAST2
• UniProt Entry Name: EHD2_HUMAN

NCBI Description

This gene encodes a member of the EH domain-containing protein family. These proteins are characterized by a C-terminal EF-hand domain, a nucleotide-binding consensus site at the N terminus and a bipartite nuclear localization signal. The encoded protein interacts with the actin cytoskeleton through an N-terminal domain and also binds to an EH domain-binding protein through the C-terminal EH domain. This interaction appears to connect clathrin-dependent endocytosis to actin, suggesting that this gene product participates in the endocytic pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

EHD2: Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: recycling endosome membrane; perinuclear region of cytoplasm; plasma membrane; endosome membrane; caveola; nucleus

Molecular Function: protein domain specific binding; protein binding; nucleic acid binding; GTP binding; hydrolase activity; calcium ion binding; ATP binding

Biological Process: metabolic process; endocytosis; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; blood coagulation