Rabbit anti-Human Cytohesin 2 Polyclonal Antibody | anti-CYTH2 antibody

Cytohesin 2 (Cytohesin-2, CYTH2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, ARNO, Protein ARNO, PH, SEC7 and Coiled-coil Domain-containing Protein 2, PSCD2, PSCD2L) (PE)

Cat. Num. AAA6391087

• Gene Names: CYTH2; ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cytohesin 2; Polyclonal Antibody; Cytohesin 2 (Cytohesin-2; CYTH2; ARF Exchange Factor; ARF Nucleotide-binding Site Opener; ARNO; Protein ARNO; PH; SEC7 and Coiled-coil Domain-containing Protein 2; PSCD2; PSCD2L) (PE); CTS18; CTS18.1; SEC7L; Sec7p-like; Sec7p-L; anti-CYTH2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PSCD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1545

• Applicable Applications for anti-CYTH2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CYTH2, aa1-400 (NP_059431.1)
• Immunogen Sequence: MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 polyclonal antibody. Lane 1: PSCD2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate. )

Product Categories/Family for anti-CYTH2 antibody

Antibodies; Pleckstrin Homology Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47157330
• NCBI GeneID: 9266
• NCBI Accession #: NM_017457.3
• NCBI GenBank Nucleotide #: NM_017457.3
• NCBI Official Full Name: Homo sapiens pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2) (PSCD2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: cytohesin 2
• NCBI Official Symbol: CYTH2
• NCBI Official Synonym Symbols: ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
• NCBI Protein Information: cytohesin-2
• Protein Family: Cytohesin

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]