Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 polyclonal antibody. Lane 1: CYTH2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human PSCD2 Polyclonal Antibody | anti-CYTH2 antibody

PSCD2 (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2)

Gene Names
CYTH2; ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
PSCD2; Polyclonal Antibody; PSCD2 (CYTH2; ARNO; PSCD2L; Cytohesin-2; ARF Exchange Factor; ARF Nucleotide-binding Site Opener; PH; SEC7 and Coiled-coil Domain-containing Protein 2); Anti -PSCD2 (CYTH2; anti-CYTH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYTH2.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Applicable Applications for anti-CYTH2 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human CYTH2, aa1-400 (NP_059431.1)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 polyclonal antibody. Lane 1: CYTH2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 polyclonal antibody. Lane 1: CYTH2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate)

Immunoprecipitation (IP)

(Immunoprecipitation of CYTH2 transfected lysate using CYTH2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with CYTH2 mouse polyclonal antibody)

Immunoprecipitation (IP) (Immunoprecipitation of CYTH2 transfected lysate using CYTH2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with CYTH2 mouse polyclonal antibody)
Related Product Information for anti-CYTH2 antibody
The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CYTH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,546 Da
NCBI Official Full Name
pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2), isoform CRA_c
NCBI Official Synonym Full Names
cytohesin 2
NCBI Official Symbol
CYTH2
NCBI Official Synonym Symbols
ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like
NCBI Protein Information
cytohesin-2; ARF exchange factor; ARF nucleotide-binding site opener; PH, SEC7 and coiled-coil domain-containing protein 2; pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2); pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2)
UniProt Protein Name
Cytohesin-2
Protein Family
UniProt Gene Name
CYTH2
UniProt Synonym Gene Names
ARNO; PSCD2; PSCD2L; Protein ARNO
UniProt Entry Name
CYH2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

Function: Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane. Ref.6

Subunit structure: Heteromer. Composed of GRASP, CYTH2 and at least one GRM1

By similarity. Interacts with ARRB1. Interacts with ARL4D; the interaction is direct. Ref.5 Ref.6

Subcellular location: Cell membrane. Cytoplasm. Note: Both isoform 1 and isoform 2 are recruited to the cell membrane through its association with ARL4A, ARL4C and ARL4D. Requires also interaction with phosphoinositides for targeting to plasma membrane. Ref.6

Tissue specificity: Ubiquitous.

Domain: The PH domain is necessary and sufficient for plasma membrane relocalization.

Sequence similarities: Contains 1 PH domain.Contains 1 SEC7 domain.

Research Articles on CYTH2

Similar Products

Product Notes

The CYTH2 cyth2 (Catalog #AAA649362) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSCD2 (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSCD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the CYTH2 cyth2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDGVYEPPD LTPEERMELE NIRRRKQELL VEIQRLREEL SEAMSEVEGL EANEGSKTLQ RNRKMAMGRK KFNMDPKKGI QFLVENELLQ NTPEEIARFL YKGEGLNKTA IGDYLGEREE LNLAVLHAFV DLHEFTDLNL VQALRQFLWS FRLPGEAQKI DRMMEAFAQR YCLCNPGVFQ STDTCYVLSF AVIMLNTSLH NPNVRDKPGL ERFVAMNRGI NEGGDLPEEL LRNLYDSIRN EPFKIPEDDG NDLTHTFFNP DREGWLLKLG GGRVKTWKRR WFILTDNCLY YFEYTTDKEP RGIIPLENLS IREVDDPRKP NCFELYIPNN KGQLIKACKT EADGRVVEGN HMVYRISAPT QEEKDEWIKS IQAAVSVDPF YEMLAARKKR ISVKKKQEQP. It is sometimes possible for the material contained within the vial of "PSCD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.