Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TNFAIP1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TNFAIP1 Polyclonal Antibody | anti-TNFAIP1 antibody

TNFAIP1 Antibody - C-terminal region

Gene Names
TNFAIP1; B12; B61; EDP1; BTBD34; hBACURD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TNFAIP1; Polyclonal Antibody; TNFAIP1 Antibody - C-terminal region; anti-TNFAIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
Sequence Length
316
Applicable Applications for anti-TNFAIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TNFAIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TNFAIP1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TNFAIP1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TNFAIP1 antibody
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.
Product Categories/Family for anti-TNFAIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
NCBI Official Synonym Full Names
TNF alpha induced protein 1
NCBI Official Symbol
TNFAIP1
NCBI Official Synonym Symbols
B12; B61; EDP1; BTBD34; hBACURD2
NCBI Protein Information
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
UniProt Protein Name
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
UniProt Gene Name
TNFAIP1
UniProt Synonym Gene Names
BACURD2; EDP1; hBACURD2
UniProt Entry Name
BACD2_HUMAN

NCBI Description

This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFAIP1: Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in regulation of cytoskeleton structure. The BCR(BACURD2) E3 ubiquitin ligase complex mediates the ubiquitination of RHOA, leading to its degradation by the proteasome, thereby regulating the actin cytoskeleton and cell migration. Its interaction with RHOB may regulate apoptosis. May enhance the PCNA-dependent DNA polymerase delta activity. Belongs to the BACURD family.

Protein type: DNA replication; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 17q22-q23

Cellular Component: cytoplasm; nucleolus; endosome

Molecular Function: protein domain specific binding; protein binding; ubiquitin-protein ligase activity; GTP-Rho binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; cell migration; embryonic development; negative regulation of Rho protein signal transduction; apoptosis; stress fiber formation; protein ubiquitination; immune response; DNA replication; protein homooligomerization; positive regulation of DNA replication

Research Articles on TNFAIP1

Similar Products

Product Notes

The TNFAIP1 tnfaip1 (Catalog #AAA3221908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFAIP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFAIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFAIP1 tnfaip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEATSRSRSQ ASPSEDEETF ELRDRVRRIH VKRYSTYDDR QLGHQSTHRD. It is sometimes possible for the material contained within the vial of "TNFAIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.