Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GOLGA5Sample Type: Human 293TAntibody Dilution: 1.0ug/mlGOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit GOLGA5 Polyclonal Antibody | anti-GOLGA5 antibody

GOLGA5 antibody - N-terminal region

Gene Names
GOLGA5; RFG5; GOLIM5; ret-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GOLGA5; Polyclonal Antibody; GOLGA5 antibody - N-terminal region; anti-GOLGA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS
Sequence Length
731
Applicable Applications for anti-GOLGA5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GOLGA5Sample Type: Human 293TAntibody Dilution: 1.0ug/mlGOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: GOLGA5Sample Type: Human 293TAntibody Dilution: 1.0ug/mlGOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(WB Suggested Anti-GOLGA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateGOLGA5 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-GOLGA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateGOLGA5 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-GOLGA5 antibody
This is a rabbit polyclonal antibody against GOLGA5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5.The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GOLGA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
golgin subfamily A member 5
NCBI Official Synonym Full Names
golgin A5
NCBI Official Symbol
GOLGA5
NCBI Official Synonym Symbols
RFG5; GOLIM5; ret-II
NCBI Protein Information
golgin subfamily A member 5
UniProt Protein Name
Golgin subfamily A member 5
Protein Family
UniProt Gene Name
GOLGA5
UniProt Synonym Gene Names
RETII; RFG5
UniProt Entry Name
GOGA5_HUMAN

NCBI Description

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. A pseudogene of this gene is located on the short arm of chromosome 5. [provided by RefSeq, Jul 2013]

Uniprot Description

GOLGA5: a member of the golgin family of proteins, whose members localize to the Golgi. Involved in regulating the architecture of the Golgi apparatus. A coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues. Highly phosphorylated during mitosis. Phosphorylation is barely detectable during interphase. Two splice variant isoforms have been described.

Protein type: Membrane protein, integral; Cytoskeletal

Chromosomal Location of Human Ortholog: 14q32.12

Cellular Component: Golgi membrane; Golgi apparatus; Golgi cisterna; cis-Golgi network; membrane; integral to membrane

Molecular Function: protein homodimerization activity; Rab GTPase binding

Biological Process: Golgi organization and biogenesis; Golgi vesicle transport

Disease: Thyroid Carcinoma, Papillary

Research Articles on GOLGA5

Similar Products

Product Notes

The GOLGA5 golga5 (Catalog #AAA3208248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLGA5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GOLGA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOLGA5 golga5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVRRKKSEPD DELLFDFLNS SQKEPTGRVE IRKEKGKTPV FQSSQTSSVS. It is sometimes possible for the material contained within the vial of "GOLGA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.