Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Integrin alpha 3B Monoclonal Antibody | anti-itga3b antibody

Mouse anti Integrin alpha 3B

Gene Names
itga3b; im:7145180; im:7155971
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, Immunohistochemistry, Western Blot
Synonyms
Integrin alpha 3B; Monoclonal Antibody; Mouse anti Integrin alpha 3B; anti-itga3b antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
54B3
Specificity
54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart.
Form/Format
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applicable Applications for anti-itga3b antibody
Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB)
Application Notes
54B3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:25 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations.
Source Note
54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Reactivity Note
A broad species reactivity is expected because of the conserved nature of the epitope.
Preparation and Storage
Store at 4 degree C, or in small aliquots at -20 degree C.
Related Product Information for anti-itga3b antibody
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Product Categories/Family for anti-itga3b antibody
References
de Melker, AA, Sterk, LM, Delwel, GO, Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
integrin, alpha 3b
NCBI Official Synonym Full Names
integrin, alpha 3b
NCBI Official Symbol
itga3b
NCBI Official Synonym Symbols
im:7145180; im:7155971
NCBI Protein Information
integrin, alpha 3b; bdf; fyd; itga3; badfin; frayed; unm tz296; unm_tz296; integrin alpha 3

Similar Products

Product Notes

The itga3b (Catalog #AAA570101) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse anti Integrin alpha 3B reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin alpha 3B can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB). 54B3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:25 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations. Researchers should empirically determine the suitability of the itga3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin alpha 3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.