Testing Data
(Figure 1: Immunohistochemistry on frozen section of human kidney
)
Mouse anti-Human Integrin alpha 3B + alpha 6B Monoclonal Antibody
Mouse anti Integrin alpha 3B + alpha 6B
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, Immunohistochemistry, Western Blot
Synonyms
Integrin alpha 3B + alpha 6B; Monoclonal Antibody; Mouse anti Integrin alpha 3B + alpha 6B; anti-Integrin alpha 3B + alpha 6B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
PB36
Specificity
PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart.
Form/Format
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applicable Applications for anti-Integrin alpha 3B + alpha 6B antibody
Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB)
Application Notes
PB36 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:50 - 1:100 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:500 for immunoblotting appliCations.
Source Note
PB36 is a Mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Reactivity Note
A broad species reactivity is expected because of the conserved nature of the epitope.
Preparation and Storage
Store at 4 degree C, or in small aliquots at -20 degree C.
Testing Data
(Figure 1: Immunohistochemistry on frozen section of human kidney )
Testing Data
(Figure 1: Immunohistochemistry on frozen section of human kidney
)
Related Product Information for anti-Integrin alpha 3B + alpha 6B antibody
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Product Categories/Family for anti-Integrin alpha 3B + alpha 6B antibody
References
de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
Similar Products
Product Notes
The Integrin alpha 3B + alpha 6B (Catalog #AAA570088) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse anti Integrin alpha 3B + alpha 6B reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin alpha 3B + alpha 6B can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB). PB36 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:50 - 1:100 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:500 for immunoblotting appliCations. Researchers should empirically determine the suitability of the Integrin alpha 3B + alpha 6B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin alpha 3B + alpha 6B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
