Rabbit DHX30 Polyclonal Antibody | anti-DHX30 antibody

DHX30 antibody - N-terminal region

Cat. Num. AAA3203170

• Gene Names: DHX30; DDX30; RETCOR; NEDMIAL
• Reactivity: Cow, Dog, Human, Mouse, Pig, Rabbit
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: DHX30; Polyclonal Antibody; DHX30 antibody - N-terminal region; anti-DHX30 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Human, Mouse, Pig, Rabbit
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
• Sequence Length: 361

• Applicable Applications for anti-DHX30 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX30
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-DHX30 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHX30 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Related Product Information for anti-DHX30 antibody

This is a rabbit polyclonal antibody against DHX30. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein has 97% sequence identity with the mouse HELG protein. Alternative splicing of this gene generates 3 transcript variants.

Product Categories/Family for anti-DHX30 antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling; Developmental Biology

NCBI and Uniprot Product Information

• NCBI GI #: 20336292
• NCBI GeneID: 22907
• NCBI Accession #: NP_619519
• NCBI GenBank Nucleotide #: NM_138614
• UniProt Accession #: Q7L2E3
• Molecular Weight: 40kDa
• NCBI Official Synonym Full Names: DExH-box helicase 30
• NCBI Official Symbol: DHX30
• NCBI Official Synonym Symbols: DDX30; RETCOR; NEDMIAL
• NCBI Protein Information: ATP-dependent RNA helicase DHX30; putative ATP-dependent RNA helicase DHX30
• UniProt Protein Name: Putative ATP-dependent RNA helicase DHX30
• Protein Family: Putative ATP-dependent RNA helicase
• UniProt Gene Name: DHX30
• UniProt Synonym Gene Names: DDX30; KIAA0890
• UniProt Entry Name: DHX30_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The family member encoded by this gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimize the function of the zinc-finger antiviral protein. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2013]

Uniprot Description

DDX30: Required for optimal function of the zinc-finger antiviral protein ZC3HAV1. Associates with mitochondrial DNA. Belongs to the DEAD box helicase family. DEAH subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; EC 3.6.4.13; RNA-binding; Helicase

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; double-stranded RNA binding; chromatin binding; ATP binding; ATP-dependent RNA helicase activity

Biological Process: RNA processing