Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse Dkk-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)

Dkk-1 Recombinant Protein | DKK1 recombinant protein

Recombinant Mouse Dkk-1 Protein

Gene Names
Dkk1; mdkk-1
Purity
>87% by SDS-PAGE.
Synonyms
Dkk-1; Recombinant Mouse Dkk-1 Protein; DKK1; SK; Dickkopf-1; DKK1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>87% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Sequence Length
272
Species
Mouse
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse Dkk-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)

SDS-Page (Recombinant Mouse Dkk-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)
Related Product Information for DKK1 recombinant protein
Recombinant Mouse Dkk-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-His272) of mouse Dkk-1 (Accession #NP_034181.2.) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for DKK1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Dickkopf-related protein 1
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 1
NCBI Official Symbol
Dkk1
NCBI Official Synonym Symbols
mdkk-1
NCBI Protein Information
dickkopf-related protein 1
UniProt Protein Name
Dickkopf-related protein 1
Protein Family
UniProt Gene Name
Dkk1
UniProt Synonym Gene Names
Dickkopf-1; Dkk-1; mDkk-1
UniProt Entry Name
DKK1_MOUSE

Uniprot Description

DKK1: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Interacts with LRP6. Interacts (via the C-termianl Cys- rich domain) with LRP5 (via beta-propeller regions 3 and 4); the interaction, enhanced by MESD and or KREMEN, antagonizes Wnt- mediated signaling. Placenta. Belongs to the dickkopf family.

Protein type: Secreted; Secreted, signal peptide; Inhibitor

Cellular Component: extracellular space; extracellular region; plasma membrane

Molecular Function: receptor antagonist activity; protein binding; low-density lipoprotein receptor binding

Biological Process: cellular morphogenesis during differentiation; negative regulation of skeletal muscle development; Wnt receptor signaling pathway; response to retinoic acid; negative regulation of Wnt receptor signaling pathway; multicellular organismal development; regulation of receptor internalization; regulation of Wnt receptor signaling pathway; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of BMP signaling pathway; mesoderm formation; hair follicle development; negative regulation of mesodermal cell fate specification; endoderm formation; forebrain development; regulation of endodermal cell fate specification; negative regulation of protein complex assembly; endoderm development; embryonic limb morphogenesis

Research Articles on DKK1

Similar Products

Product Notes

The DKK1 dkk1 (Catalog #AAA9141892) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MMVVCAAAAV RFLAVFTMMA LCSLPLLGAS ATLNSVLINS NAIKNLPPPL GGAGGQPGSA VSVAPGVLYE GGNKYQTLDN YQPYPCAEDE ECGSDEYCSS PSRGAAGVGG VQICLACRKR RKRCMRHAMC CPGNYCKNGI CMPSDHSHFP RGEIEESIIE NLGNDHNAAA GDGYPRRTTL TSKIYHTKGQ EGSVCLRSSD CAAGLCCARH FWSKICKPVL KEGQVCTKHK RKGSHGLEIF QRCYCGEGLA CRIQKDHHQA SNSSRLHTCQ RH. It is sometimes possible for the material contained within the vial of "Dkk-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.