Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ACVR1B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 46 kDa.)

ACVR1B recombinant protein

Recombinant Human ACVR1B Protein

Gene Names
ACVR1B; ALK4; SKR2; ACTRIB; ACVRLK4
Purity
>97% by SDS-PAGE.
Synonyms
ACVR1B; Recombinant Human ACVR1B Protein; ACTRIB Protein; Human; ACVRLK4 Protein; ALK4 Protein; SKR2 Protein; ACVR1B recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Sequence Length
505
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ACVR1B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 46 kDa.)

SDS-Page (Recombinant Human ACVR1B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 46 kDa.)
Related Product Information for ACVR1B recombinant protein
Recombinant Human ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Glu 126) of human ACVR1B (Accession #NP_004293.1) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for ACVR1B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
91
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
activin receptor type-1B isoform a
NCBI Official Synonym Full Names
activin A receptor type 1B
NCBI Official Symbol
ACVR1B
NCBI Official Synonym Symbols
ALK4; SKR2; ACTRIB; ACVRLK4
NCBI Protein Information
activin receptor type-1B
UniProt Protein Name
Activin receptor type-1B
Protein Family
UniProt Gene Name
ACVR1B
UniProt Synonym Gene Names
ACVRLK4; ALK4; ACTR-IB; ALK-4; SKR2
UniProt Entry Name
ACV1B_HUMAN

NCBI Description

This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]

Uniprot Description

ALK4: Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine- threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C- terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2. ACVRIB is abundantly expressed in systemic sclerosis patient fibroblasts and production of collagen is also induced by activin-A/INHBA. This suggests that the activin/ACRV1B signaling mechanism is involved in systemic sclerosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Membrane protein, integral; EC 2.7.11.30; Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; activin receptor complex; receptor complex

Molecular Function: activin receptor activity; metal ion binding; transmembrane receptor protein serine/threonine kinase activity; transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; activin receptor activity, type I; ubiquitin protein ligase binding; growth factor binding; activin binding; SMAD binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: development of primary female sexual characteristics; central nervous system development; in utero embryonic development; positive regulation of erythrocyte differentiation; protein amino acid autophosphorylation; peptidyl-threonine phosphorylation; activin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of activin receptor signaling pathway; hair follicle development; regulation of transcription, DNA-dependent; transmembrane receptor protein serine/threonine kinase signaling pathway; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell growth; G1/S transition of mitotic cell cycle

Research Articles on ACVR1B

Similar Products

Product Notes

The ACVR1B acvr1b (Catalog #AAA9141754) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAESAGASSF FPLVVLLLAG SGGSGPRGVQ ALLCACTSCL QANYTCETDG ACMVSIFNLD GMEHHVRTCI PKVELVPAGK PFYCLSSEDL RNTHCCYTDY CNRIDLRVPS GHLKEPEHPS MWGPVE. It is sometimes possible for the material contained within the vial of "ACVR1B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.