SDS-Page
(Recombinant Human Tetranectin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27 kDa.)
Tetranectin Recombinant Protein | CLEC3B recombinant protein
Recombinant Human Tetranectin Protein
Gene Names
CLEC3B; TN; TNA
Purity
>97% by SDS-PAGE.
Synonyms
Tetranectin; Recombinant Human Tetranectin Protein; CLEC3B recombinant protein
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Sequence Length
202
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human Tetranectin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27 kDa.)
SDS-Page
(Recombinant Human Tetranectin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 27 kDa.)
Related Product Information for CLEC3B recombinant protein
Recombinant Human Tetranectin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu22-Val202) of human Tetranectin (Accession #NP_003269.2) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for CLEC3B recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Tetranectin
NCBI Official Synonym Full Names
C-type lectin domain family 3 member B
NCBI Official Symbol
CLEC3B
NCBI Official Synonym Symbols
TN; TNA
NCBI Protein Information
tetranectin
UniProt Protein Name
Tetranectin
Protein Family
UniProt Gene Name
CLEC3B
UniProt Synonym Gene Names
TNA; TN
UniProt Entry Name
TETN_HUMAN
Uniprot Description
CLEC3B: Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 3p22-p21.3
Cellular Component: extracellular matrix; extracellular space; granular component; cytoplasm; extracellular region
Molecular Function: heparin binding; calcium ion binding; carbohydrate binding
Biological Process: ossification; skeletal development; bone mineralization
Research Articles on CLEC3B
Similar Products
Product Notes
The CLEC3B clec3b (Catalog #AAA9141852) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EPPTQKPKKI VNAKKDVVNT KMFEELKSRL DTLAQEVALL KEQQALQTVC LKGTKVHMKC FLAFTQTKTF HEASEDCISR GGTLSTPQTG SENDALYEYL RQSVGNEAEI WLGLNDMAAE GTWVDMTGAR IAYKNWETEI TAQPDGGKTE NCAVLSGAAN GKWFDKRCRD QLPYICQFGI V. It is sometimes possible for the material contained within the vial of "Tetranectin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
