Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human VSIG4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

VSIG4 recombinant protein

Recombinant Human VSIG4 Protein

Gene Names
VSIG4; CRIg; Z39IG
Purity
>97% by SDS-PAGE.
Synonyms
VSIG4; Recombinant Human VSIG4 Protein; CRIg; Z39IG; VSIG4 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
Sequence Length
321
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human VSIG4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

SDS-Page (Recombinant Human VSIG4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)
Related Product Information for VSIG4 recombinant protein
Recombinant Human VSIG4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg20-Pro283) of human VSIG4 (Accession #NP_009199.1) fused with an Fc, 6xHis tag at the C-terminus.
Product Categories/Family for VSIG4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
V-set and immunoglobulin domain-containing protein 4 isoform 4
NCBI Official Synonym Full Names
V-set and immunoglobulin domain containing 4
NCBI Official Symbol
VSIG4
NCBI Official Synonym Symbols
CRIg; Z39IG
NCBI Protein Information
V-set and immunoglobulin domain-containing protein 4
UniProt Protein Name
V-set and immunoglobulin domain-containing protein 4
UniProt Gene Name
VSIG4
UniProt Synonym Gene Names
CRIg; Z39IG
UniProt Entry Name
VSIG4_HUMAN

NCBI Description

This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

VSIG4: Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: Xq12-q13.3

Cellular Component: integral to membrane

Molecular Function: protein binding

Biological Process: negative regulation of T cell proliferation; complement activation, alternative pathway; negative regulation of interleukin-2 production

Research Articles on VSIG4

Similar Products

Product Notes

The VSIG4 vsig4 (Catalog #AAA9141826) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RPILEVPESV TGPWKGDVNL PCTYDPLQGY TQVLVKWLVQ RGSDPVTIFL RDSSGDHIQQ AKYQGRLHVS HKVPGDVSLQ LSTLEMDDRS HYTCEVTWQT PDGNQVVRDK ITELRVQKLS VSKPTVTTGS GYGFTVPQGM RISLQCQARG SPPISYIWYK QQTNNQEPIK VATLSTLLFK PAVIADSGSY FCTAKGQVGS EQHSDIVKFV VKDSSKLLKT KTEAPTTMTY PLKATSTVKQ SWDWTTDMDG YLGETSAGPG KSLP. It is sometimes possible for the material contained within the vial of "VSIG4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.