Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Liver)

Rabbit PC4 Polyclonal Antibody | anti-SUB1 antibody

PC4 antibody - middle region

Gene Names
SUB1; P15; PC4; p14
Reactivity
Cow, Dog, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PC4; Polyclonal Antibody; PC4 antibody - middle region; anti-SUB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
Sequence Length
127
Applicable Applications for anti-SUB1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Liver)

Immunohistochemistry (IHC) (Human Liver)

Western Blot (WB)

(WB Suggested Anti-PC4 Antibody Titration: 0.5-1.0ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SUB1 is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-PC4 Antibody Titration: 0.5-1.0ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SUB1 is expressed in HepG2)
Related Product Information for anti-SUB1 antibody
This is a rabbit polyclonal antibody against PC4. It was validated on Western Blot and immunohistochemistry

Target Description: PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
activated RNA polymerase II transcriptional coactivator p15
NCBI Official Synonym Full Names
SUB1 homolog, transcriptional regulator
NCBI Official Symbol
SUB1
NCBI Official Synonym Symbols
P15; PC4; p14
NCBI Protein Information
activated RNA polymerase II transcriptional coactivator p15
UniProt Protein Name
Activated RNA polymerase II transcriptional coactivator p15
UniProt Gene Name
SUB1
UniProt Synonym Gene Names
PC4; RPO2TC1; PC4
UniProt Entry Name
TCP4_HUMAN

Uniprot Description

PC4: a transcriptional coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, nonspecifically to double-stranded DNA (ds DNA). Interacts with CSTF2. Its activity is controlled by phosphorylation of the regulatory domain. Phosphorylation inactivates both dsDNA-binding and cofactor function. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.

Protein type: DNA-binding; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 5p13.3

Cellular Component: transcription factor complex; nucleolus; nucleus

Molecular Function: protein binding; transcription coactivator activity; single-stranded DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on SUB1

Similar Products

Product Notes

The SUB1 sub1 (Catalog #AAA3224692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PC4 antibody - middle region reacts with Cow, Dog, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PC4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SUB1 sub1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMFQIGKMRY VSVRDFKGKV LIDIREYWMD PEGEMKPGRK GISLNPEQWS. It is sometimes possible for the material contained within the vial of "PC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.