Rabbit PC4 Polyclonal Antibody | anti-SUB1 antibody

Anti-PC4 Antibody

Cat. Num. AAA178854

• Gene Names: SUB1; P15; PC4; p14
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: PC4; Polyclonal Antibody; Anti-PC4 Antibody; p14; P15; PC4 LSB; Positive cofactor 4; RPO2TC1; Sub1; P53999; Activated RNA polymerase II transcriptional coactivator p15; SUB1 homolog; transcriptional regulator; anti-SUB1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 127

• Applicable Applications for anti-SUB1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of PC4 expression in rat liver extract (lane 1), HELA whole cell lysates (lane 2) and U2OS whole cell lysates (lane 3). PC4 at 19KD was detected using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(PC4 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(PC4 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(PC4 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-SUB1 antibody

Rabbit IgG polyclonal antibody for Activated RNA polymerase II transcriptional coactivator p15(SUB1) detection.
Background: Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

References

1. "Entrez Gene SUB1: SUB1 homolog (S. cerevisiae)".
2. Kretzschmar M, Kaiser K, Lottspeich F, Meisterernst M (August 1994). "A novel mediator of class II gene transcription with homology to viral immediate-early transcriptional regulators". Cell 78 (3): 525-34.
3. Ge H, Roeder RG (August 1994). "Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes". Cell 78 (3): 513-23.

NCBI and Uniprot Product Information

• NCBI GI #: 217330646
• NCBI GeneID: 10923
• NCBI Accession #: NP_006704.3
• NCBI GenBank Nucleotide #: NM_006713.3
• UniProt Accession #: P53999; Q96L29
• Molecular Weight: 14,395 Da
• NCBI Official Full Name: activated RNA polymerase II transcriptional coactivator p15
• NCBI Official Synonym Full Names: SUB1 homolog, transcriptional regulator
• NCBI Official Symbol: SUB1
• NCBI Official Synonym Symbols: P15; PC4; p14
• NCBI Protein Information: activated RNA polymerase II transcriptional coactivator p15
• UniProt Protein Name: Activated RNA polymerase II transcriptional coactivator p15
• Protein Family: PC4 and SFRS1-interacting protein
• UniProt Gene Name: SUB1
• UniProt Synonym Gene Names: PC4; RPO2TC1; PC4

Uniprot Description

PC4: a transcriptional coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, nonspecifically to double-stranded DNA (ds DNA). Interacts with CSTF2. Its activity is controlled by phosphorylation of the regulatory domain. Phosphorylation inactivates both dsDNA-binding and cofactor function. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.

Protein type: DNA-binding; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5p13.3

Cellular Component: nucleolus; nucleus; transcription factor complex

Molecular Function: protein binding; single-stranded DNA binding; transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter