Activated RNA polymerase II transcriptional coactivator p15 Recombinant Protein | SUB1 recombinant protein

Recombinant Human Activated RNA polymerase II transcriptional coactivator p15

Cat. Num. AAA962922

• Gene Names: SUB1; P15; PC4; p14
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Activated RNA polymerase II transcriptional coactivator p15; Recombinant Human Activated RNA polymerase II transcriptional coactivator p15; Positive cofactor 4; PC4; SUB1 homolog; p14; SUB1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-127aa; Full Length
• Sequence: PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
• Sequence Length: 127

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SUB1 recombinant protein

General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA)

Product Categories/Family for SUB1 recombinant protein

Transcription

References

A novel mediator of class II gene transcription with homology to viral immediate-early transcriptional regulators.Kretzschmar M., Kaiser K., Lottspeich F., Meisterernst M.Cell 78:525-534(1994) Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes.Ge H., Roeder R.G.Cell 78:513-523(1994) Phosphorylation negatively regulates the function of coactivator PC4.Ge H., Zhao Y., Chait B.T., Roeder R.G.Proc. Natl. Acad. Sci. U.S.A. 91:12691-12695(1994) The coactivator p15 (PC4) initiates transcriptional activation during TFIIA-TFIID-promoter complex formation.Kaiser K., Stelzer G., Meisterernst M.EMBO J. 14:3520-3527(1995) A dynamic model for PC4 coactivator function in RNA polymerase II transcription.Malik S., Guermah M., Roeder R.G.Proc. Natl. Acad. Sci. U.S.A. 95:2192-2197(1998) Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination.Calvo O., Manley J.L.Mol. Cell 7:1013-1023(2001) Gradual phosphorylation regulates PC4 coactivator function.Jonker H.R.A., Wechselberger R.W., Pinkse M., Kaptein R., Folkers G.E.FEBS J. 273:1430-1444(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) C-terminal domain of transcription cofactor PC4 reveals dimeric ssDNA binding site.Brandsen J., Werten S., van der Vliet P.C., Meisterernst M., Kroon J., Gros P.Nat. Struct. Biol. 4:900-903(1997) The intrinsically unstructured domain of PC4 modulates the activity of the structured core through inter- and intramolecular interactions.Jonker H.R.A., Wechselberger R.W., Boelens R., Kaptein R., Folkers G.E.Biochemistry 45:5067-5081(2006) A global transcription cofactor bound to juxtaposed strands of unwound DNA.Werten S., Moras D.Nat. Struct. Biol. 13:181-182(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 217330646
• NCBI GeneID: 10923
• NCBI Accession #: NP_006704.3
• NCBI GenBank Nucleotide #: NM_006713.3
• UniProt Accession #: P53999; Q96L29
• Molecular Weight: 30.3 kDa
• NCBI Official Full Name: activated RNA polymerase II transcriptional coactivator p15
• NCBI Official Synonym Full Names: SUB1 homolog, transcriptional regulator
• NCBI Official Symbol: SUB1
• NCBI Official Synonym Symbols: P15; PC4; p14
• NCBI Protein Information: activated RNA polymerase II transcriptional coactivator p15
• UniProt Protein Name: Activated RNA polymerase II transcriptional coactivator p15
• Protein Family: Activated RNA polymerase II transcriptional coactivator
• UniProt Gene Name: SUB1
• UniProt Synonym Gene Names: PC4; RPO2TC1; PC4
• UniProt Entry Name: TCP4_HUMAN

Uniprot Description

PC4: a transcriptional coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, nonspecifically to double-stranded DNA (ds DNA). Interacts with CSTF2. Its activity is controlled by phosphorylation of the regulatory domain. Phosphorylation inactivates both dsDNA-binding and cofactor function. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 5p13.3

Cellular Component: nucleolus; nucleus; transcription factor complex

Molecular Function: protein binding; single-stranded DNA binding; transcription coactivator activity

Biological Process: positive regulation of transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter