Rabbit anti-Human Tubulin beta-3 Chain Polyclonal Antibody | anti-TUBB3 antibody

Tubulin beta-3 Chain (Tubulin beta-III, TUBB3, Tubulin beta-4 Chain, TUBB4, CDCBM, beta-4, CFEOM3A) (PE)

Cat. Num. AAA6397544

• Gene Names: TUBB3; CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Tubulin beta-3 Chain; Polyclonal Antibody; Tubulin beta-3 Chain (Tubulin beta-III; TUBB3; Tubulin beta-4 Chain; TUBB4; CDCBM; beta-4; CFEOM3A) (PE); anti-TUBB3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TUBB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1736

• Applicable Applications for anti-TUBB3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human TUBB3, aa1-450 (NP_006077.2).
• Immunogen Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TUBB3 expression in transfected 293T cell line by TUBB3 polyclonal antibody. Lane 1: TUBB3 transfected lysate (50.4kD). Lane 2: Non-transfected lysate. )

Product Categories/Family for anti-TUBB3 antibody

Antibodies; Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 50592995
• NCBI GeneID: 10381
• NCBI Accession #: NM_006086.2
• NCBI GenBank Nucleotide #: NM_006086.2
• NCBI Official Full Name: Homo sapiens tubulin, beta 3 (TUBB3), mRNA
• NCBI Official Synonym Full Names: tubulin beta 3 class III
• NCBI Official Symbol: TUBB3
• NCBI Official Synonym Symbols: CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
• NCBI Protein Information: tubulin beta-3 chain
• Protein Family: Tubulin

NCBI Description

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010]