Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAS2R135Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse TAS2R135 Polyclonal Antibody | anti-TAS2R135 antibody

TAS2R135 Antibody - N-terminal region

Gene Names
Tas2r135; mt2r38; Tas2r35
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TAS2R135; Polyclonal Antibody; TAS2R135 Antibody - N-terminal region; anti-TAS2R135 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLCLVAVVGNGFIIIALGMKWLLRRTLSAHNKLLISLAASRFCLQCVVIG
Sequence Length
312
Applicable Applications for anti-TAS2R135 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TAS2R135
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAS2R135Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAS2R135Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TAS2R135 antibody
Putative taste receptor which may play a role in the perception of bitterness.
Product Categories/Family for anti-TAS2R135 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
taste receptor type 2 member 135
NCBI Official Synonym Full Names
taste receptor, type 2, member 135
NCBI Official Symbol
Tas2r135
NCBI Official Synonym Symbols
mt2r38; Tas2r35
NCBI Protein Information
taste receptor type 2 member 135
UniProt Protein Name
Taste receptor type 2 member 135
Protein Family
UniProt Gene Name
Tas2r135
UniProt Synonym Gene Names
T2r38; Tas2r35; T2R135; T2R35; mT2r38
UniProt Entry Name
TR135_MOUSE

Uniprot Description

TAS2R60: Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5. Belongs to the G-protein coupled receptor T2R family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, T2R family; Receptor, GPCR

Cellular Component: integral to membrane; membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity; taste receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of bitter taste; G-protein coupled receptor protein signaling pathway; response to stimulus; sensory perception of taste; signal transduction

Research Articles on TAS2R135

Similar Products

Product Notes

The TAS2R135 tas2r135 (Catalog #AAA3223986) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS2R135 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TAS2R135 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAS2R135 tas2r135 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLCLVAVVGN GFIIIALGMK WLLRRTLSAH NKLLISLAAS RFCLQCVVIG. It is sometimes possible for the material contained within the vial of "TAS2R135, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.