Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NNTSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse NNT Polyclonal Antibody | anti-NNT antibody

NNT Antibody - middle region

Gene Names
Nnt; AI323702; BB168308; 4930423F13Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
NNT; Polyclonal Antibody; NNT Antibody - middle region; anti-NNT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKK
Sequence Length
1086
Applicable Applications for anti-NNT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse NNT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NNTSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NNTSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NNT antibody
The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane. May play a role in reactive oxygen species (ROS) detoxification in the adrenal gland (By similarity).
Product Categories/Family for anti-NNT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
NAD(P) transhydrogenase, mitochondrial
NCBI Official Synonym Full Names
nicotinamide nucleotide transhydrogenase
NCBI Official Symbol
Nnt
NCBI Official Synonym Symbols
AI323702; BB168308; 4930423F13Rik
NCBI Protein Information
NAD(P) transhydrogenase, mitochondrial
UniProt Protein Name
NAD(P) transhydrogenase, mitochondrial
Protein Family
UniProt Gene Name
Nnt
UniProt Entry Name
NNTM_MOUSE

Uniprot Description

NNT: The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane. May play a role in reactive oxygen species (ROS) detoxification in the adrenal gland. Defects in NNT are the cause of glucocorticoid deficiency type 4 (GCCD4). A rare, potentially lethal, autosomal recessive disorder characterized by resistance to ACTH action on the adrenal cortex, adrenal insufficiency and an inability of the adrenal cortex to produce cortisol. It usually presents in the neonatal period or in early childhood with episodes of hypoglycemia and other symptoms related to cortisol deficiency, including failure to thrive, recurrent illnesses or infections, convulsions, and shock. In a small number of patients hypoglycemia can be sufficiently severe and persistent that it leads to serious long-term neurological damage or death. The diagnosis is readily confirmed with a low plasma cortisol measurement in the presence of an elevated ACTH level, and normal aldosterone and plasma renin measurements.

Protein type: EC 1.6.1.2; Membrane protein, multi-pass; Mitochondrial; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Membrane protein, integral; Oxidoreductase

Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: NAD(P) transhydrogenase activity; NAD(P)+ transhydrogenase (AB-specific) activity; oxidoreductase activity; NADP binding

Biological Process: proton transport; cell redox homeostasis

Research Articles on NNT

Similar Products

Product Notes

The NNT nnt (Catalog #AAA3223590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NNT Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NNT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NNT nnt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVDLKESGEG QGGYAKEMSK EFIEAEMKLF AQQCKEVDIL ISTALIPGKK. It is sometimes possible for the material contained within the vial of "NNT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.