Western Blot (WB)
(Host: RabbitTarget Name: SCTSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Rat SCT Polyclonal Antibody | anti-SCT antibody
SCT Antibody - middle region
Gene Names
Sct; Secr
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
SCT; Polyclonal Antibody; SCT Antibody - middle region; anti-SCT antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENI
Sequence Length
134
Applicable Applications for anti-SCT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat SCT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SCTSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SCTSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SCT antibody
stimulates the secretion of bicarbonate-containing pancreatic fluid; may play a role in digestion.
Product Categories/Family for anti-SCT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
secretin
NCBI Official Synonym Full Names
secretin
NCBI Official Symbol
Sct
NCBI Official Synonym Symbols
Secr
NCBI Protein Information
secretin
UniProt Protein Name
Secretin
Protein Family
UniProt Gene Name
Sct
UniProt Entry Name
SECR_RAT
NCBI Description
stimulates the secretion of bicarbonate-containing pancreatic fluid; may play a role in digestion [RGD, Feb 2006]
Uniprot Description
SCT: Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach. Belongs to the glucagon family.
Protein type: Secreted, signal peptide; Secreted
Cellular Component: extracellular space
Molecular Function: hormone activity; protein N-terminus binding; receptor binding
Biological Process: dentate gyrus development; positive regulation of cAMP biosynthetic process; visual learning; brain development; negative regulation of neuron apoptosis; embryonic gut development
Research Articles on SCT
Similar Products
Product Notes
The SCT sct (Catalog #AAA3223564) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCT Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCT sct for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFVLPAPPRT PRHSDGTFTS ELSRLQDSAR LQRLLQGLVG KRSEEDTENI. It is sometimes possible for the material contained within the vial of "SCT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
