Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: QTRTD1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human QTRT2 Polyclonal Antibody | anti-QTRT2 antibody

QTRT2 Antibody - middle region

Gene Names
QTRT2; QTRTD1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
QTRT2; Polyclonal Antibody; QTRT2 Antibody - middle region; anti-QTRT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEK
Sequence Length
415
Applicable Applications for anti-QTRT2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human QTRTD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: QTRTD1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: QTRTD1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-QTRT2 antibody
This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-QTRT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
queuine tRNA-ribosyltransferase accessory subunit 2 isoform 2
NCBI Official Synonym Full Names
queuine tRNA-ribosyltransferase accessory subunit 2
NCBI Official Symbol
QTRT2
NCBI Official Synonym Symbols
QTRTD1
NCBI Protein Information
queuine tRNA-ribosyltransferase accessory subunit 2
UniProt Protein Name
Queuine tRNA-ribosyltransferase subunit QTRTD1
UniProt Gene Name
QTRTD1
UniProt Entry Name
QTRD1_HUMAN

NCBI Description

This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

QTRTD1: Interacts with QTRT1 to form an active queuine tRNA- ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1- yl)amino)methyl)-7-deazaguanosine). Belongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily.

Protein type: EC 2.4.2.29

Chromosomal Location of Human Ortholog: 3q13.31

Cellular Component: cytoplasm; mitochondrial outer membrane; mitochondrion

Molecular Function: protein heterodimerization activity; protein homodimerization activity; queuine tRNA-ribosyltransferase activity

Biological Process: queuosine biosynthetic process; tRNA modification

Research Articles on QTRT2

Similar Products

Product Notes

The QTRT2 qtrtd1 (Catalog #AAA3222188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The QTRT2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's QTRT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the QTRT2 qtrtd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFDYQPNPEE TLLQQNGTQE EIKCMDQIKK IETTGCNQEI TSFEINLKEK. It is sometimes possible for the material contained within the vial of "QTRT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.