Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SCNN1DSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SCNN1D Polyclonal Antibody | anti-SCNN1D antibody

SCNN1D Antibody - C-terminal region

Gene Names
SCNN1D; ENaCd; SCNED; dNaCh; ENaCdelta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SCNN1D; Polyclonal Antibody; SCNN1D Antibody - C-terminal region; anti-SCNN1D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLRRAWFSWPRASPASGASSIKPEASQMPPPAGGTSDDPEPSGPHLPRVM
Sequence Length
638
Applicable Applications for anti-SCNN1D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SCNN1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SCNN1DSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SCNN1DSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SCNN1D antibody
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
Product Categories/Family for anti-SCNN1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
amiloride-sensitive sodium channel subunit delta
NCBI Official Synonym Full Names
sodium channel epithelial 1 delta subunit
NCBI Official Symbol
SCNN1D
NCBI Official Synonym Symbols
ENaCd; SCNED; dNaCh; ENaCdelta
NCBI Protein Information
amiloride-sensitive sodium channel subunit delta
UniProt Protein Name
Amiloride-sensitive sodium channel subunit delta
UniProt Gene Name
SCNN1D
UniProt Synonym Gene Names
DNACH; Delta-ENaC; ENaCD
UniProt Entry Name
SCNND_HUMAN

Uniprot Description

ENaC-delta: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1D subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Channel, sodium; Transporter, ion channel; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.3-p36.2

Cellular Component: membrane; integral to membrane; plasma membrane; actin cytoskeleton

Molecular Function: amiloride-sensitive sodium channel activity; protein binding

Biological Process: sensory perception of taste; sodium ion transport; response to stimulus; transmembrane transport

Research Articles on SCNN1D

Similar Products

Product Notes

The SCNN1D scnn1d (Catalog #AAA3221294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCNN1D Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCNN1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCNN1D scnn1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLRRAWFSWP RASPASGASS IKPEASQMPP PAGGTSDDPE PSGPHLPRVM. It is sometimes possible for the material contained within the vial of "SCNN1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.