Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DAOSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DAO Polyclonal Antibody | anti-DAO antibody

DAO Antibody - middle region

Gene Names
DAO; DAAO; OXDA; DAMOX
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DAO; Polyclonal Antibody; DAO Antibody - middle region; anti-DAO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYN
Sequence Length
347
Applicable Applications for anti-DAO antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DAO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DAOSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DAOSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DAO antibody
This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally occurring L-amino acids. Its biological function is not known; it may act as a detoxifying agent which removes D-amino acids that accumulate during aging. In mice, it degrades D-serine, a co-agonist of the NMDA receptor. This gene may play a role in the pathophysiology of schizophrenia.
Product Categories/Family for anti-DAO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
D-amino-acid oxidase
NCBI Official Synonym Full Names
D-amino acid oxidase
NCBI Official Symbol
DAO
NCBI Official Synonym Symbols
DAAO; OXDA; DAMOX
NCBI Protein Information
D-amino-acid oxidase
UniProt Protein Name
D-amino-acid oxidase
Protein Family
UniProt Gene Name
DAO
UniProt Synonym Gene Names
DAMOX; DAAO; DAMOX; DAO
UniProt Entry Name
OXDA_HUMAN

NCBI Description

This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally occurring L-amino acids. Its biological function is not known; it may act as a detoxifying agent which removes D-amino acids that accumulate during aging. In mice, it degrades D-serine, a co-agonist of the NMDA receptor. This gene may play a role in the pathophysiology of schizophrenia. [provided by RefSeq, Jul 2008]

Uniprot Description

DAO: Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D- amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids. Belongs to the DAMOX/DASOX family.

Protein type: Oxidoreductase; Amino Acid Metabolism - glycine, serine and threonine; Amino Acid Metabolism - arginine and proline; Other Amino Acids Metabolism - D-Arginine and D-ornithine; EC 1.4.3.3

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: peroxisomal membrane; peroxisomal matrix; mitochondrial outer membrane; peroxisome; cytosol

Molecular Function: protein dimerization activity; protein binding; cofactor binding; D-amino-acid oxidase activity; receptor binding

Biological Process: proline catabolic process; glyoxylate metabolic process; dopamine biosynthetic process; leucine metabolic process

Disease: Schizophrenia

Research Articles on DAO

Similar Products

Product Notes

The DAO dao (Catalog #AAA3221380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DAO Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAO dao for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAAGLWQPYL SDPNNPQEAD WSQQTFDYLL SHVHSPNAEN LGLFLISGYN. It is sometimes possible for the material contained within the vial of "DAO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.