Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAP2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit RAP2B Polyclonal Antibody | anti-RAP2B antibody

RAP2B antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAP2B; Polyclonal Antibody; RAP2B antibody - C-terminal region; anti-RAP2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDE
Sequence Length
183
Applicable Applications for anti-RAP2B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAP2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-RAP2B AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-RAP2B antibody
This is a rabbit polyclonal antibody against RAP2B. It was validated on Western Blot

Target Description: This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.
Product Categories/Family for anti-RAP2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ras-related protein Rap-2b
NCBI Official Synonym Full Names
RAP2B, member of RAS oncogene family
NCBI Official Symbol
RAP2B
NCBI Protein Information
ras-related protein Rap-2b
UniProt Protein Name
Ras-related protein Rap-2b
Protein Family
UniProt Gene Name
RAP2B
UniProt Entry Name
RAP2B_HUMAN

NCBI Description

This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq, Jul 2008]

Uniprot Description

RAP2B: Small GTP-binding protein which cycles between a GDP- bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells. Belongs to the small GTPase superfamily. Ras family.

Protein type: G protein, monomeric, Ras; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 3q25.2

Cellular Component: tight junction; membrane; recycling endosome membrane; plasma membrane; cytosol; lipid raft

Molecular Function: protein domain specific binding; GDP binding; GTP binding

Biological Process: microvillus biogenesis; platelet activation; signal transduction; positive regulation of protein amino acid autophosphorylation; negative regulation of cell migration; Rap protein signal transduction

Research Articles on RAP2B

Similar Products

Product Notes

The RAP2B rap2b (Catalog #AAA3216388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAP2B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAP2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAP2B rap2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YERVPMILVG NKVDLEGERE VSYGEGKALA EEWSCPFMET SAKNKASVDE. It is sometimes possible for the material contained within the vial of "RAP2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.