Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ICK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit ICK Polyclonal Antibody | anti-ICK antibody

ICK antibody - C-terminal region

Gene Names
ICK; ECO; MRK; LCK2; EJM10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ICK; Polyclonal Antibody; ICK antibody - C-terminal region; anti-ICK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLP
Sequence Length
632
Applicable Applications for anti-ICK antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ICK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-ICK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-ICK antibody
This is a rabbit polyclonal antibody against ICK. It was validated on Western Blot

Target Description: Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified.
Product Categories/Family for anti-ICK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
serine/threonine-protein kinase ICK
NCBI Official Synonym Full Names
intestinal cell kinase
NCBI Official Symbol
ICK
NCBI Official Synonym Symbols
ECO; MRK; LCK2; EJM10
NCBI Protein Information
serine/threonine-protein kinase ICK
UniProt Protein Name
Serine/threonine-protein kinase ICK
UniProt Gene Name
ICK
UniProt Synonym Gene Names
KIAA0936; hICK; LCK2; MRK
UniProt Entry Name
ICK_HUMAN

NCBI Description

Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ICK: a CMGC kinase of the RCK family. May play a role in cardiac development. Expressed in heart, brain, placenta, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Also expressed in many cancer cell lines. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CMGC; EC 2.7.11.22; CMGC group; RCK family

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; cyclin-dependent protein kinase activity; magnesium ion binding; ATP binding

Biological Process: regulation of cell cycle; multicellular organismal development; intraflagellar transport; cilium biogenesis; signal transduction; protein amino acid phosphorylation

Disease: Endocrine-cerebroosteodysplasia

Research Articles on ICK

Similar Products

Product Notes

The ICK ick (Catalog #AAA3216162) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ICK antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ICK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ICK ick for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFESVLDLKP SEPVGTGNSA PTQTSYQRRD TPTLRSAAKQ HYLKHSRYLP. It is sometimes possible for the material contained within the vial of "ICK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.