Western Blot (WB)
(WB Suggested Anti-FBXL20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Rabbit FBXL20 Polyclonal Antibody | anti-FBXL20 antibody
FBXL20 antibody - N-terminal region
Gene Names
FBXL20; Fbl2; Fbl20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXL20; Polyclonal Antibody; FBXL20 antibody - N-terminal region; anti-FBXL20 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNM
Sequence Length
436
Applicable Applications for anti-FBXL20 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FBXL20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Western Blot (WB)
(WB Suggested Anti-FBXL20 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-FBXL20 antibody
This is a rabbit polyclonal antibody against FBXL20. It was validated on Western Blot
Target Description: Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains
Target Description: Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains
Product Categories/Family for anti-FBXL20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
F-box/LRR-repeat protein 20 isoform 1
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 20
NCBI Official Symbol
FBXL20
NCBI Official Synonym Symbols
Fbl2; Fbl20
NCBI Protein Information
F-box/LRR-repeat protein 20
UniProt Protein Name
F-box/LRR-repeat protein 20
Protein Family
UniProt Gene Name
FBXL20
UniProt Synonym Gene Names
FBL2
UniProt Entry Name
FXL20_HUMAN
NCBI Description
Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Uniprot Description
FBXL20: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. Role in neural transmission. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 17q12
Cellular Component: cytoplasm
Biological Process: behavioral fear response
Research Articles on FBXL20
Similar Products
Product Notes
The FBXL20 fbxl20 (Catalog #AAA3214918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXL20 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXL20 fbxl20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTFAQNCRNI EVLNLNGCTK TTDATCTSLS KFCSKLRHLD LASCTSITNM. It is sometimes possible for the material contained within the vial of "FBXL20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
