Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Pancreas tissue at an antibody concentration of 5ug/ml using anti-TRPM5 antibody )

Rabbit TRPM5 Polyclonal Antibody | anti-TRPM5 antibody

TRPM5 antibody - N-terminal region

Gene Names
TRPM5; MTR1; LTRPC5
Reactivity
Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRPM5; Polyclonal Antibody; TRPM5 antibody - N-terminal region; anti-TRPM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
Sequence Length
1165
Applicable Applications for anti-TRPM5 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM5
Protein Size
1165 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Pancreas tissue at an antibody concentration of 5ug/ml using anti-TRPM5 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Pancreas tissue at an antibody concentration of 5ug/ml using anti-TRPM5 antibody )

Western Blot (WB)

(WB Suggested Anti-TRPM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TRPM5 antibody
This is a rabbit polyclonal antibody against TRPM5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.
Product Categories/Family for anti-TRPM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily M member 5
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily M member 5
NCBI Official Symbol
TRPM5
NCBI Official Synonym Symbols
MTR1; LTRPC5
NCBI Protein Information
transient receptor potential cation channel subfamily M member 5
UniProt Protein Name
Transient receptor potential cation channel subfamily M member 5
UniProt Gene Name
TRPM5
UniProt Synonym Gene Names
LTrpC-5; LTrpC5
UniProt Entry Name
TRPM5_HUMAN

NCBI Description

This gene encodes a member of the transient receptor potential (TRP) protein family, which is a diverse group of proteins with structural features typical of ion channels. This protein plays an important role in taste transduction, and has characteristics of a calcium-activated, non-selective cation channel that carries Na+, K+, and Cs+ ions equally well, but not Ca(2+) ions. It is activated by lower concentrations of intracellular Ca(2+), and inhibited by higher concentrations. It is also a highly temperature-sensitive, heat activated channel showing a steep increase of inward currents at temperatures between 15 and 35 degrees Celsius. This gene is located within the Beckwith-Wiedemann syndrome critical region-1 on chromosome 11p15.5, and has been shown to be imprinted, with exclusive expression from the paternal allele. [provided by RefSeq, Oct 2010]

Uniprot Description

TRPM5: Voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. Monovalent- specific, non-selective cation channel that mediates the transport of Na(+), K(+) and Cs(+) ions equally well. Activated directly by increases in intracellular Ca(2+), but is impermeable to it. Gating is voltage-dependent and displays rapid activation and deactivation kinetics upon channel stimulation even during sustained elevations in Ca(2+). Also activated by a fast intracellular Ca(2+) increase in response to inositol 1,4,5- triphosphate-producing receptor agonists. The channel is blocked by extracellular acidification. External acidification has 2 effects, a fast reversible block of the current and a slower irreversible enhancement of current inactivation. Is a highly temperature-sensitive, heat activated channel showing a steep increase of inward currents at temperatures between 15 and 35 degrees Celsius. Heat activation is due to a shift of the voltage- dependent activation curve to negative potentials. Activated by arachidonic acid in vitro. May be involved in perception of bitter, sweet and umami tastes. May also be involved in sensing semiochemicals. Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM5 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: cell soma; dendrite; integral to membrane; plasma membrane

Molecular Function: calcium activated cation channel activity; ion channel activity; potassium channel activity; sodium channel activity; voltage-gated ion channel activity

Biological Process: sensory perception of taste

Research Articles on TRPM5

Similar Products

Product Notes

The TRPM5 trpm5 (Catalog #AAA3202490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPM5 antibody - N-terminal region reacts with Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPM5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRPM5 trpm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKHISEQRAG YGGTGSIEIP VLCLLVNGDP NTLERISRAV EQAAPWLILV. It is sometimes possible for the material contained within the vial of "TRPM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.