Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TRPC3 antibody - N-terminal region validated by WB using brainstem, Cerebellum, Thalamus, Hipppcampus, Cerebral Cortex)

Rabbit TRPC3 Polyclonal Antibody | anti-TRPC3 antibody

TRPC3 antibody - N-terminal region

Gene Names
TRPC3; TRP3; SCA41
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRPC3; Polyclonal Antibody; TRPC3 antibody - N-terminal region; anti-TRPC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG
Sequence Length
848
Applicable Applications for anti-TRPC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human TRPC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(TRPC3 antibody - N-terminal region validated by WB using brainstem, Cerebellum, Thalamus, Hipppcampus, Cerebral Cortex)

Western Blot (WB) (TRPC3 antibody - N-terminal region validated by WB using brainstem, Cerebellum, Thalamus, Hipppcampus, Cerebral Cortex)

Western Blot (WB)

(WB Suggested Anti-TRPC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TRPC3 antibody
This is a rabbit polyclonal antibody against TRPC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.
Product Categories/Family for anti-TRPC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
short transient receptor potential channel 3 isoform b
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 3
NCBI Official Symbol
TRPC3
NCBI Official Synonym Symbols
TRP3; SCA41
NCBI Protein Information
short transient receptor potential channel 3
UniProt Protein Name
Short transient receptor potential channel 3
UniProt Gene Name
TRPC3
UniProt Synonym Gene Names
TRP3; TrpC3; TRP-3; hTrp-3; hTrp3
UniProt Entry Name
TRPC3_HUMAN

NCBI Description

The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

TRPC3 iso3: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol 1,4,5- triphosphate receptors (ITPR) with bound IP3. May also be activated by internal calcium store depletion. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC3 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, cation

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; store-operated calcium channel activity; calcium channel activity

Biological Process: axon guidance; platelet activation; calcium ion transport; phototransduction; response to calcium ion; blood coagulation; transmembrane transport; response to ATP

Disease: Spinocerebellar Ataxia 41

Research Articles on TRPC3

Similar Products

Product Notes

The TRPC3 trpc3 (Catalog #AAA3214021) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPC3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRPC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRPC3 trpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEGSPSLRRM TVMREKGRRQ AVRGPAFMFN DRGTSLTAEE ERFLDAAEYG. It is sometimes possible for the material contained within the vial of "TRPC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.