Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rat Hippocamus )

Rabbit TRPV4 Polyclonal Antibody | anti-TRPV4 antibody

TRPV4 antibody - middle region

Gene Names
TRPV4; SMAL; VRL2; BCYM3; CMT2C; SPSMA; TRP12; VROAC; HMSN2C; OTRPC4; SSQTL1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRPV4; Polyclonal Antibody; TRPV4 antibody - middle region; anti-TRPV4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Sequence Length
811
Applicable Applications for anti-TRPV4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rat Hippocamus )

Immunohistochemistry (IHC) (Rat Hippocamus )

Western Blot (WB)

(Host: RabbitTarget Name: TRPV4Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRPV4Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRPV4Sample Type: PANC1Antibody Dilution: 1.0ug/mlTRPV4 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (Host: RabbitTarget Name: TRPV4Sample Type: PANC1Antibody Dilution: 1.0ug/mlTRPV4 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB)

(WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-TRPV4 antibody
This is a rabbit polyclonal antibody against TRPV4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TRPV4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 4 isoform b
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily V member 4
NCBI Official Symbol
TRPV4
NCBI Official Synonym Symbols
SMAL; VRL2; BCYM3; CMT2C; SPSMA; TRP12; VROAC; HMSN2C; OTRPC4; SSQTL1
NCBI Protein Information
transient receptor potential cation channel subfamily V member 4
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 4
UniProt Gene Name
TRPV4
UniProt Synonym Gene Names
VRL2; VROAC; TrpV4; OTRPC4; TRP12; VRL-2; VR-OAC
UniProt Entry Name
TRPV4_HUMAN

NCBI Description

This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Uniprot Description

TRPV4: a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by low pH, citrate and phorbol esters. Increase of intracellular Ca(2+) potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism. Promotes cell-cell junction formation in skin keratinocytes and plays an important role in the formation and/or maintenance of functional intercellular barriers. Acts as a regulator of intracellular Ca(2+) in synoviocytes. Plays an obligatory role as a molecular component in the nonselective cation channel activation induced by 4-alpha-phorbol 12,13-didecanoate and hypotonic stimulation in synoviocytes and also regulates production of IL-8. Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV4 sub-subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: cortical actin cytoskeleton; cell surface; focal adhesion; growth cone; adherens junction; lamellipodium; cytoplasmic microtubule; plasma membrane; integral to membrane; cytoplasmic vesicle; filopodium; cilium

Molecular Function: calcium channel activity; microtubule binding; beta-tubulin binding; actin binding; protein kinase binding; calmodulin binding; actin filament binding; protein binding; protein kinase C binding; osmosensor activity; SH2 domain binding; cation channel activity; alpha-tubulin binding; ATP binding

Biological Process: intercellular junction assembly; actin filament organization; regulation of response to osmotic stress; osmosensory signaling pathway; cellular calcium ion homeostasis; vasopressin secretion; positive regulation of microtubule depolymerization; elevation of cytosolic calcium ion concentration; hyperosmotic salinity response; response to mechanical stimulus; calcium ion transport; actin cytoskeleton reorganization; cell volume homeostasis; cortical microtubule organization and biogenesis; transmembrane transport; microtubule polymerization

Disease: Brachyolmia Type 3; Scapuloperoneal Spinal Muscular Atrophy; Hereditary Motor And Sensory Neuropathy, Type Iic; Sodium Serum Level Quantitative Trait Locus 1; Spondyloepiphyseal Dysplasia, Maroteaux Type; Parastremmatic Dwarfism; Spinal Muscular Atrophy, Distal, Congenital Nonprogressive; Digital Arthropathy-brachydactyly, Familial; Metatropic Dysplasia; Spondylometaphyseal Dysplasia, Kozlowski Type

Research Articles on TRPV4

Similar Products

Product Notes

The TRPV4 trpv4 (Catalog #AAA3202574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPV4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPV4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRPV4 trpv4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVDEVNWSHW NQNLGIINED PGKNETYQYY GFSHTVGRLR RDRWSSVVPR. It is sometimes possible for the material contained within the vial of "TRPV4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.