Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-TRPC4 antibody )

Rabbit TRPC4 Polyclonal Antibody | anti-TRPC4 antibody

TRPC4 antibody - middle region

Gene Names
TRPC4; TRP4; HTRP4; HTRP-4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRPC4; Polyclonal Antibody; TRPC4 antibody - middle region; anti-TRPC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
Sequence Length
977
Applicable Applications for anti-TRPC4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 82%; Horse: 77%; Human: 100%; Mouse: 100%; Pig: 85%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRPC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-TRPC4 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-TRPC4 antibody )

Western Blot (WB)

(Host: RabbitTarget Name: TRPC4Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRPC4Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRPC4Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRPC4Sample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRPC4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRPC4Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-TRPC4 antibody
This is a rabbit polyclonal antibody against TRPC4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.
Product Categories/Family for anti-TRPC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
short transient receptor potential channel 4 isoform alpha
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 4
NCBI Official Symbol
TRPC4
NCBI Official Synonym Symbols
TRP4; HTRP4; HTRP-4
NCBI Protein Information
short transient receptor potential channel 4
UniProt Protein Name
Short transient receptor potential channel 4
UniProt Gene Name
TRPC4
UniProt Synonym Gene Names
TrpC4; hTrp-4; hTrp4
UniProt Entry Name
TRPC4_HUMAN

NCBI Description

This gene encodes a member of the canonical subfamily of transient receptor potential cation channels. The encoded protein forms a non-selective calcium-permeable cation channel that is activated by Gq-coupled receptors and tyrosine kinases, and plays a role in multiple processes including endothelial permeability, vasodilation, neurotransmitter release and cell proliferation. Single nucleotide polymorphisms in this gene may be associated with generalized epilepsy with photosensitivity. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

TRPC4: Form a receptor-activated non-selective calcium permeant cation channel. Acts as a cell-cell contact-dependent endothelial calcium entry channel. Probably operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Mediates cation entry, with an enhanced permeability to barium over calcium. May also be activated by intracellular calcium store depletion. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC4 sub-subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, calcium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 13q13.3

Cellular Component: cortical cytoskeleton; cell surface; basolateral plasma membrane; plasma membrane; intercellular junction; caveola

Molecular Function: store-operated calcium channel activity; protein binding; cadherin binding; beta-catenin binding

Biological Process: axon guidance; calcium ion transport; gamma-aminobutyric acid secretion; oligodendrocyte differentiation; transmembrane transport

Research Articles on TRPC4

Similar Products

Product Notes

The TRPC4 trpc4 (Catalog #AAA3202499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPC4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPC4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRPC4 trpc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPFKSEKVVV EDTVPIIPKE KHAKEEDSSI DYDLNLPDTV THEDYVTTRL. It is sometimes possible for the material contained within the vial of "TRPC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.