Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Prostate tissue at an antibody concentration of 5ug/ml using anti-TRPM8 antibody )

Rabbit TRPM8 Polyclonal Antibody | anti-TRPM8 antibody

TRPM8 antibody - N-terminal region

Gene Names
TRPM8; TRPP8; LTRPC6; trp-p8; LTrpC-6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRPM8; Polyclonal Antibody; TRPM8 antibody - N-terminal region; anti-TRPM8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
Sequence Length
1104
Applicable Applications for anti-TRPM8 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Prostate tissue at an antibody concentration of 5ug/ml using anti-TRPM8 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Prostate tissue at an antibody concentration of 5ug/ml using anti-TRPM8 antibody )

Western Blot (WB)

(WB Suggested Anti-TRPM8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPM8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)
Related Product Information for anti-TRPM8 antibody
This is a rabbit polyclonal antibody against TRPM8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.
Product Categories/Family for anti-TRPM8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily M member 8
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily M member 8
NCBI Official Symbol
TRPM8
NCBI Official Synonym Symbols
TRPP8; LTRPC6; trp-p8; LTrpC-6
NCBI Protein Information
transient receptor potential cation channel subfamily M member 8
UniProt Protein Name
Transient receptor potential cation channel subfamily M member 8
UniProt Gene Name
TRPM8
UniProt Synonym Gene Names
LTRPC6; TRPP8; LTrpC-6; LTrpC6; Trp-p8
UniProt Entry Name
TRPM8_HUMAN

Uniprot Description

TRPM8: Receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. Activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. Involved in menthol sensation. Permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. Activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing. Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM8 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Channel, cation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: endoplasmic reticulum membrane; external side of plasma membrane; integral to membrane; lipid raft; plasma membrane

Molecular Function: calcium channel activity; protein binding; protein homodimerization activity

Biological Process: cellular calcium ion homeostasis; detection of temperature stimulus; protein homotetramerization; response to cold; thermoception

Research Articles on TRPM8

Similar Products

Product Notes

The TRPM8 trpm8 (Catalog #AAA3202545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPM8 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPM8 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRPM8 trpm8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YILDNNHTHL LLVDNGCHGH PTVEAKLRNQ LEKYISERTI QDSNYGGKIP. It is sometimes possible for the material contained within the vial of "TRPM8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.