Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SRR expression in transfected 293T cell line by SRR polyclonal antibody. Lane 1: SRR transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Serine Racemase Polyclonal Antibody | anti-SRR antibody

Serine Racemase (SRR, D-serine Ammonia-lyase, D-serine Dehydratase, L-serine Ammonia-lyase, L-serine Dehydratase, ILV1, ISO1)

Gene Names
SRR; ILV1; ISO1
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
Serine Racemase; Polyclonal Antibody; Serine Racemase (SRR; D-serine Ammonia-lyase; D-serine Dehydratase; L-serine Ammonia-lyase; L-serine Dehydratase; ILV1; ISO1); Anti -Serine Racemase (SRR; anti-SRR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SRR.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Applicable Applications for anti-SRR antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human SRR, aa1-340 (NP_068766.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SRR expression in transfected 293T cell line by SRR polyclonal antibody. Lane 1: SRR transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SRR expression in transfected 293T cell line by SRR polyclonal antibody. Lane 1: SRR transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SRR transfected lysate using SRR rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SRR mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SRR transfected lysate using SRR rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SRR mouse polyclonal antibody.)
Product Categories/Family for anti-SRR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,566 Da
NCBI Official Full Name
serine racemase
NCBI Official Synonym Full Names
serine racemase
NCBI Official Symbol
SRR
NCBI Official Synonym Symbols
ILV1; ISO1
NCBI Protein Information
serine racemase; D-serine dehydratase; L-serine dehydratase; D-serine ammonia-lyase; L-serine ammonia-lyase
UniProt Protein Name
Serine racemase
Protein Family
UniProt Gene Name
SRR
UniProt Entry Name
SRR_HUMAN

Uniprot Description

Function: Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Ref.1 Ref.8

Catalytic activity: L-serine = D-serine. Ref.8L-serine = pyruvate + NH3. Ref.8D-serine = pyruvate + NH3. Ref.8

Cofactor: Pyridoxal phosphate. Ref.8

Enzyme regulation: Allosterically activated by magnesium, and possibly also other divalent metal cations. Allosterically activated by ATP, ADP or GTP. Competitively inhibited by malonate.

Subunit structure: Homodimer. Ref.8

Tissue specificity: Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver. Ref.2

Post-translational modification: S-nitrosylated, leading to decrease the enzyme activity

By similarity.

Sequence similarities: Belongs to the serine/threonine dehydratase family.

Biophysicochemical propertiesKinetic parameters:KM=6.5 mM for L-serine Ref.8

Research Articles on SRR

Similar Products

Product Notes

The SRR srr (Catalog #AAA649861) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Serine Racemase (SRR, D-serine Ammonia-lyase, D-serine Dehydratase, L-serine Ammonia-lyase, L-serine Dehydratase, ILV1, ISO1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Serine Racemase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the SRR srr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCAQYCISFA DVEKAHINIR DSIHLTPVLT SSILNQLTGR NLFFKCELFQ KTGSFKIRGA LNAVRSLVPD ALERKPKAVV THSSGNHGQA LTYAAKLEGI PAYIVVPQTA PDCKKLAIQA YGASIVYCEP SDESRENVAK RVTEETEGIM VHPNQEPAVI AGQGTIALEV LNQVPLVDAL VVPVGGGGML AGIAITVKAL KPSVKVYAAE PSNADDCYQS KLKGKLMPNL YPPETIADGV KSSIGLNTWP IIRDLVDDIF TVTEDEIKCA TQLVWERMKL LIEPTAGVGV AAVLSQHFQT VSPEVKNICI VLSGGNVDLT SSITWVKQAE RPASYQSVSV. It is sometimes possible for the material contained within the vial of "Serine Racemase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.