Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C9orf156 polyclonal antibody. Western Blot analysis of C9orf156 expression in rat brain.)

Mouse anti-Human, Rat C9orf156 Polyclonal Antibody | anti-C9orf156 antibody

C9orf156 (Nef-associated Protein 1, Thioesterase NAP1, HSPC219, NAP1)

Gene Names
C9orf156; NAP1; HSPC219; RP11-23B15.3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C9orf156; Polyclonal Antibody; C9orf156 (Nef-associated Protein 1; Thioesterase NAP1; HSPC219; NAP1); Anti -C9orf156 (Nef-associated Protein 1; anti-C9orf156 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C9orf156. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS
Applicable Applications for anti-C9orf156 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C9orf156, aa1-441 (AAH02863.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(C9orf156 polyclonal antibody. Western Blot analysis of C9orf156 expression in rat brain.)

Western Blot (WB) (C9orf156 polyclonal antibody. Western Blot analysis of C9orf156 expression in rat brain.)

Western Blot (WB)

(Western Blot analysis of C9orf156 expression in transfected 293T cell line by C9orf156 polyclonal antibody. Lane 1: C9orf156 transfected lysate (48.51kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C9orf156 expression in transfected 293T cell line by C9orf156 polyclonal antibody. Lane 1: C9orf156 transfected lysate (48.51kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-C9orf156 antibody
C9orf156 hydrolyzes acyl-CoA thioesters (in vitro). It has a preference for substrates with medium chain length (C10-C14). Inactive towards substrates with C18 or C20 aliphatic chains. Its physiological function is not known.
Product Categories/Family for anti-C9orf156 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,587 Da
NCBI Official Full Name
chromosome 9 open reading frame 156, isoform CRA_c
NCBI Official Synonym Full Names
chromosome 9 open reading frame 156
NCBI Official Symbol
C9orf156
NCBI Official Synonym Symbols
NAP1; HSPC219; RP11-23B15.3
NCBI Protein Information
nef-associated protein 1; thioesterase NAP1; Nef associated protein 1; Nef (lentivirus myristoylated factor) associated protein 1
UniProt Protein Name
Nef-associated protein 1
UniProt Gene Name
C9orf156
UniProt Synonym Gene Names
NAP1
UniProt Entry Name
NAP1_HUMAN

Uniprot Description

C9orf156: Hydrolyzes acyl-CoA thioesters (in vitro). Has a preference for substrates with medium chain length (C10-C14). Inactive towards substrates with C18 or C20 aliphatic chains. Its physiological substrate is not known. Belongs to the UPF0066 (VirR) family.

Protein type: EC 3.1.2.-; Hydrolase

Chromosomal Location of Human Ortholog: 9q22.33

Molecular Function: hydrolase activity

Biological Process: viral reproduction; metabolic process

Research Articles on C9orf156

Similar Products

Product Notes

The C9orf156 c9orf156 (Catalog #AAA645442) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C9orf156 (Nef-associated Protein 1, Thioesterase NAP1, HSPC219, NAP1) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C9orf156 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the C9orf156 c9orf156 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRGLEEPGPR PTATPCGCVK PALETGNLLT EPVGYLESCF SAKNGTPRQP SICSYSRACL RIRKRIFNNP EHSLMGLEQF SHVWILFVFH KNGHLSCKAK VQPPRLNGAK TGVFSTRSPH RPNAIGLTLA KLEKVEGGAI YLSGIDMIHG TPVLDIKPYI AEYDSPQNVM EPLADFNLQN NQHTPNTVSQ SDSKTDSCDQ RQLSGCDEPQ PHHSTKRKPK CPEDRTSEEN YLTHSDTARI QQAFPMHREI AVDFGLESRR DQSSSVAEEQ IGPYCPEKSF SEKGTDKKLE RVEGAAVLQG SRAETQPMAP HCPAGRADGA PRSVVPAWVT EAPVATLEVR FTPHAEMDLG QLSSQDVGQA SFKYFQSAEE AKRAIEAVLS ADPRSVYRRK LCQDRLFYFT VDIAHVTCWF GDGFAEVLRI KPASEPVHMT GPVGSLVSLG S. It is sometimes possible for the material contained within the vial of "C9orf156, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.