Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Serine racemase Recombinant Protein | SRR recombinant protein

Recombinant Human Serine racemase

Gene Names
SRR; ILV1; ISO1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine racemase; Recombinant Human Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; SRR recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-340aa; Full Length
Sequence
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Sequence Length
340
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SRR recombinant protein
Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.
Product Categories/Family for SRR recombinant protein
References
"Human serine racemase: molecular cloning, genomic organization and functional expression." De Miranda J., Santoro A., Engelender S., Wolosker H. Gene 256:183-188(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.6 kDa
NCBI Official Full Name
serine racemase isoform a
NCBI Official Synonym Full Names
serine racemase
NCBI Official Symbol
SRR
NCBI Official Synonym Symbols
ILV1; ISO1
NCBI Protein Information
serine racemase
UniProt Protein Name
Serine racemase
Protein Family
UniProt Gene Name
SRR
UniProt Entry Name
SRR_HUMAN

Uniprot Description

SRR: Catalyzes the synthesis of D-serine from L-serine. D- serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Belongs to the serine/threonine dehydratase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Isomerase; EC 5.1.1.18; EC 4.3.1.17; EC 4.3.1.18

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: apical part of cell; cell soma; cytoplasm; plasma membrane

Molecular Function: ATP binding; calcium ion binding; D-serine ammonia-lyase activity; glycine binding; L-serine ammonia-lyase activity; magnesium ion binding; PDZ domain binding; protein homodimerization activity; pyridoxal phosphate binding; serine racemase activity; threonine racemase activity

Biological Process: aging; brain development; L-serine metabolic process; protein homotetramerization; pyruvate biosynthetic process; response to drug; response to lipopolysaccharide; response to morphine; serine family amino acid metabolic process

Research Articles on SRR

Similar Products

Product Notes

The SRR srr (Catalog #AAA1288880) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340aa; Full Length. The amino acid sequence is listed below: MCAQYCISFA DVEKAHINIR DSIHLTPVLT SSILNQLTGR NLFFKCELFQ KTGSFKIRGA LNAVRSLVPD ALERKPKAVV THSSGNHGQA LTYAAKLEGI PAYIVVPQTA PDCKKLAIQA YGASIVYCEP SDESRENVAK RVTEETEGIM VHPNQEPAVI AGQGTIALEV LNQVPLVDAL VVPVGGGGML AGIAITVKAL KPSVKVYAAE PSNADDCYQS KLKGKLMPNL YPPETIADGV KSSIGLNTWP IIRDLVDDIF TVTEDEIKCA TQLVWERMKL LIEPTAGVGV AAVLSQHFQT VSPEVKNICI VLSGGNVDLT SSITWVKQAE RPASYQSVSV. It is sometimes possible for the material contained within the vial of "Serine racemase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual