Serine racemase Recombinant Protein | SRR recombinant protein

Recombinant Human Serine racemase

Cat. Num. AAA1288880

• Gene Names: SRR; ILV1; ISO1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine racemase; Recombinant Human Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; SRR recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-340aa; Full Length
• Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
• Sequence Length: 340

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SRR recombinant protein

Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.

Product Categories/Family for SRR recombinant protein

Neuroscience

References

"Human serine racemase: molecular cloning, genomic organization and functional expression." De Miranda J., Santoro A., Engelender S., Wolosker H. Gene 256:183-188(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 11345492
• NCBI GeneID: 63826
• NCBI Accession #: NP_068766.1
• NCBI GenBank Nucleotide #: NM_021947.2
• UniProt Accession #: Q9GZT4; Q6IA55; D3DTI5
• Molecular Weight: 52.6 kDa
• NCBI Official Full Name: serine racemase isoform a
• NCBI Official Synonym Full Names: serine racemase
• NCBI Official Symbol: SRR
• NCBI Official Synonym Symbols: ILV1; ISO1
• NCBI Protein Information: serine racemase
• UniProt Protein Name: Serine racemase
• Protein Family: Serine racemase
• UniProt Gene Name: SRR
• UniProt Entry Name: SRR_HUMAN

Uniprot Description

SRR: Catalyzes the synthesis of D-serine from L-serine. D- serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Belongs to the serine/threonine dehydratase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Isomerase; EC 5.1.1.18; EC 4.3.1.17; EC 4.3.1.18

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: apical part of cell; cell soma; cytoplasm; plasma membrane

Molecular Function: ATP binding; calcium ion binding; D-serine ammonia-lyase activity; glycine binding; L-serine ammonia-lyase activity; magnesium ion binding; PDZ domain binding; protein homodimerization activity; pyridoxal phosphate binding; serine racemase activity; threonine racemase activity

Biological Process: aging; brain development; L-serine metabolic process; protein homotetramerization; pyruvate biosynthetic process; response to drug; response to lipopolysaccharide; response to morphine; serine family amino acid metabolic process