Rabbit anti-Human Serine Racemase Polyclonal Antibody | anti-SRR antibody

Serine Racemase (SRR, D-serine Ammonia-lyase, D-serine Dehydratase, L-serine Ammonia-lyase, L-serine Dehydratase, ILV1, ISO1) (FITC)

Cat. Num. AAA6395084

• Gene Names: SRR; ILV1; ISO1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Serine Racemase; Polyclonal Antibody; Serine Racemase (SRR; D-serine Ammonia-lyase; D-serine Dehydratase; L-serine Ammonia-lyase; L-serine Dehydratase; ILV1; ISO1) (FITC); EC=4.3.1.17; EC=4.3.1.18; EC=5.1.1.18; anti-SRR antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SRR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-SRR antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SRR, aa1-340 (NP_068766.1).
• Immunogen Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SRR expression in transfected 293T cell line by SRR polyclonal antibody. Lane 1: SRR transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SRR antibody

Antibodies; Enzymes; Racemase

NCBI and Uniprot Product Information

• NCBI GI #: 11345492
• NCBI GeneID: 63826
• NCBI Accession #: NP_068766.1
• NCBI GenBank Nucleotide #: NM_021947.1
• UniProt Accession #: Q9GZT4; Q6IA55; D3DTI5
• Molecular Weight: 36,566 Da
• NCBI Official Full Name: serine racemase isoform a
• NCBI Official Synonym Full Names: serine racemase
• NCBI Official Symbol: SRR
• NCBI Official Synonym Symbols: ILV1; ISO1
• NCBI Protein Information: serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase
• UniProt Protein Name: Serine racemase
• Protein Family: Serine racemase
• UniProt Gene Name: SRR
• UniProt Entry Name: SRR_HUMAN

Uniprot Description

SRR: Catalyzes the synthesis of D-serine from L-serine. D- serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Belongs to the serine/threonine dehydratase family.

Protein type: EC 5.1.1.18; Isomerase; EC 4.3.1.18; Amino Acid Metabolism - glycine, serine and threonine; EC 4.3.1.17

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cell soma; apical part of cell; cytoplasm; plasma membrane

Molecular Function: protein homodimerization activity; glycine binding; threonine racemase activity; L-serine ammonia-lyase activity; magnesium ion binding; calcium ion binding; serine racemase activity; D-serine ammonia-lyase activity; ATP binding; PDZ domain binding; pyridoxal phosphate binding

Biological Process: response to drug; pyruvate biosynthetic process; L-serine metabolic process; response to morphine; response to lipopolysaccharide; brain development; serine family amino acid metabolic process; protein homotetramerization; aging