Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human Serine Racemase Polyclonal Antibody | anti-SRR antibody

Serine Racemase (SRR, D-serine Ammonia-lyase, D-serine Dehydratase, L-serine Ammonia-lyase, L-serine Dehydratase, ILV1, ISO1) (AP)

Gene Names
SRR; ILV1; ISO1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Serine Racemase; Polyclonal Antibody; Serine Racemase (SRR; D-serine Ammonia-lyase; D-serine Dehydratase; L-serine Ammonia-lyase; L-serine Dehydratase; ILV1; ISO1) (AP); EC=4.3.1.17; EC=4.3.1.18; EC=5.1.1.18; anti-SRR antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SRR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SRR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SRR, aa1-340 (NP_068766.1).
Immunogen Sequence
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SRR expression in transfected 293T cell line by SRR polyclonal antibody. Lane 1: SRR transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SRR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,566 Da
NCBI Official Full Name
serine racemase isoform a
NCBI Official Synonym Full Names
serine racemase
NCBI Official Symbol
SRR
NCBI Official Synonym Symbols
ILV1; ISO1
NCBI Protein Information
serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase
UniProt Protein Name
Serine racemase
Protein Family
UniProt Gene Name
SRR
UniProt Entry Name
SRR_HUMAN

Uniprot Description

SRR: Catalyzes the synthesis of D-serine from L-serine. D- serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Belongs to the serine/threonine dehydratase family.

Protein type: EC 5.1.1.18; Isomerase; EC 4.3.1.18; Amino Acid Metabolism - glycine, serine and threonine; EC 4.3.1.17

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cell soma; apical part of cell; cytoplasm; plasma membrane

Molecular Function: protein homodimerization activity; glycine binding; threonine racemase activity; L-serine ammonia-lyase activity; magnesium ion binding; calcium ion binding; serine racemase activity; D-serine ammonia-lyase activity; ATP binding; PDZ domain binding; pyridoxal phosphate binding

Biological Process: response to drug; pyruvate biosynthetic process; L-serine metabolic process; response to morphine; response to lipopolysaccharide; brain development; serine family amino acid metabolic process; protein homotetramerization; aging

Research Articles on SRR

Similar Products

Product Notes

The SRR srr (Catalog #AAA6395081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Serine Racemase (SRR, D-serine Ammonia-lyase, D-serine Dehydratase, L-serine Ammonia-lyase, L-serine Dehydratase, ILV1, ISO1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Serine Racemase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRR srr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Serine Racemase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual