Rabbit DLG3 Polyclonal Antibody | anti-DLG3 antibody

DLG3 Rabbit pAb

Cat. Num. AAA9142478

• Gene Names: DLG3; MRX; XLMR; MRX90; NEDLG; SAP102; PPP1R82
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity purification
• Synonyms: DLG3; Polyclonal Antibody; DLG3 Rabbit pAb; MRX; MRX90; NEDLG; PPP1R82; SAP102; XLMR; anti-DLG3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: QYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL

• Applicable Applications for anti-DLG3 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: WB: 1:500-1:2000; IHC: 1:100-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 464-817 of human DLG3 (NP_066943.2).
• Positive Samples: 293T, K-562, Mouse brain, Rat brain
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using DLG3 pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using DLG3 antibody at dilution of 1:100 (40x lens).)

Related Product Information for anti-DLG3 antibody

Background: This gene encodes a member of the membrane-associated guanylate kinase protein family. The encoded protein may play a role in clustering of NMDA receptors at excitatory synapses. It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein. Mutations in this gene have been associated with X-linked mental retardation. Alternatively spliced transcript variants have been described.

Product Categories/Family for anti-DLG3 antibody

Neuroscience; Cell Type Marker; Neuron marker; Research; Neuroscience; Cell Type Marker; Dendrite marker; Research; Neuroscience; Cell Type Marker; Synapse marker

NCBI and Uniprot Product Information

• NCBI GI #: 261862237
• NCBI GeneID: 1741
• NCBI Accession #: NP_001159750.1
• NCBI GenBank Nucleotide #: NM_001166278.1
• UniProt Accession #: Q92796; Q5JUW6; Q5JUW7; Q9ULI8; B4E0H1; D3DVU5
• Molecular Weight: 42,112 Da
• NCBI Official Full Name: disks large homolog 3 isoform c
• NCBI Official Synonym Full Names: discs large MAGUK scaffold protein 3
• NCBI Official Symbol: DLG3
• NCBI Official Synonym Symbols: MRX; XLMR; MRX90; NEDLG; SAP102; PPP1R82
• NCBI Protein Information: disks large homolog 3
• UniProt Protein Name: Disks large homolog 3
• Protein Family: Disks large
• UniProt Gene Name: DLG3
• UniProt Synonym Gene Names: KIAA1232; SAP-102; SAP102

NCBI Description

This gene encodes a member of the membrane-associated guanylate kinase protein family. The encoded protein may play a role in clustering of NMDA receptors at excitatory synapses. It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein. Mutations in this gene have been associated with X-linked mental retardation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Uniprot Description

Required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.