Western Blot (WB)
(Host: RabbitTarget Name: RITA1Sample Type: HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human RITA1 Polyclonal Antibody | anti-RITA1 antibody
RITA1 Antibody - C-terminal
Gene Names
RITA1; RITA; C12orf52
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RITA1; Polyclonal Antibody; RITA1 Antibody - C-terminal; anti-RITA1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK
Sequence Length
269
Applicable Applications for anti-RITA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RITA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RITA1Sample Type: HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RITA1Sample Type: HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RITA1 antibody
This is a rabbit polyclonal antibody against RITA1. It was validated on Western Blot
Target Description: RITA1 is a tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. It shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. And it may play a role in neurogenesis.
Target Description: RITA1 is a tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. It shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. And it may play a role in neurogenesis.
Product Categories/Family for anti-RITA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Synonym Full Names
RBPJ interacting and tubulin associated 1
NCBI Official Symbol
RITA1
NCBI Official Synonym Symbols
RITA; C12orf52
NCBI Protein Information
RBPJ-interacting and tubulin-associated protein 1
UniProt Protein Name
RBPJ-interacting and tubulin-associated protein 1
Protein Family
UniProt Gene Name
RITA1
UniProt Synonym Gene Names
C12orf52; RITA; PSEC0043
UniProt Entry Name
RITA1_HUMAN
Research Articles on RITA1
Similar Products
Product Notes
The RITA1 rita1 (Catalog #AAA3220134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RITA1 Antibody - C-terminal reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RITA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RITA1 rita1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TNGPQDLRPS TSGVTFRSPL VTSRARSVSI SVPSTPRRGG ATQKPKPPWK. It is sometimes possible for the material contained within the vial of "RITA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
