Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CORO7Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CORO7 Polyclonal Antibody | anti-CORO7 antibody

CORO7 Antibody - N-terminal region

Gene Names
CORO7; CRN7; POD1; 0610011B16Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CORO7; Polyclonal Antibody; CORO7 Antibody - N-terminal region; anti-CORO7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RDGALVGTACKDKQLRIFDPRTKPRASQSTQAHENSRDSRLAWMGTWEHL
Sequence Length
840
Applicable Applications for anti-CORO7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CORO7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CORO7Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CORO7Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CORO7 antibody
This is a rabbit polyclonal antibody against CORO7. It was validated on Western Blot

Target Description: CORO7 may play a role in the maintenance of the Golgi apparatus morphology and in the protein export from the Golgi.
Product Categories/Family for anti-CORO7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
coronin-7 isoform 1
NCBI Official Synonym Full Names
coronin 7
NCBI Official Symbol
CORO7
NCBI Official Synonym Symbols
CRN7; POD1; 0610011B16Rik
NCBI Protein Information
coronin-7
UniProt Protein Name
Coronin-7
Protein Family
UniProt Gene Name
CORO7
UniProt Synonym Gene Names
Crn7
UniProt Entry Name
CORO7_HUMAN

NCBI Description

This gene encodes a member of the coronin protein family. However, unlike other coronin proteins, it is not an actin-binding protein but rather functions as an F-actin regulator directing anterograde Golgi to endosome transport. The encoded protein has two tandem WD-40 domain repeats and localizes to the trans-Golgi network. The protein undergoes K33-linked polyubiquitination via an E3 ligase complex. It is thought to play an essential role in maintenance of Golgi apparatus morphology. Alternative splicing results in multiple transcripts variants; some of which form read-through transcripts with a neighboring gene. [provided by RefSeq, Dec 2016]

Uniprot Description

coronin 7: May play a role in the maintenance of the Golgi apparatus morphology and in the protein export from the Golgi. Belongs to the WD repeat coronin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: Golgi membrane; Golgi apparatus; membrane; cytoplasmic membrane-bound vesicle; integral to membrane; trans-Golgi network; cytosol; actin cytoskeleton

Molecular Function: actin filament binding; protein binding; actin binding

Biological Process: protein transport; actin filament polymerization; Golgi to endosome transport; actin cytoskeleton organization and biogenesis

Research Articles on CORO7

Similar Products

Product Notes

The CORO7 coro7 (Catalog #AAA3218359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CORO7 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CORO7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CORO7 coro7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RDGALVGTAC KDKQLRIFDP RTKPRASQST QAHENSRDSR LAWMGTWEHL. It is sometimes possible for the material contained within the vial of "CORO7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.