Western Blot (WB)
(Host: RabbitTarget Name: RAB6BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human RAB6B Polyclonal Antibody | anti-RAB6B antibody
RAB6B Antibody - C-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAB6B; Polyclonal Antibody; RAB6B Antibody - C-terminal region; anti-RAB6B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGC
Sequence Length
208
Applicable Applications for anti-RAB6B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB6B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RAB6BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RAB6BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAB6B antibody
This is a rabbit polyclonal antibody against RAB6B. It was validated on Western Blot
Target Description: RAB6B seems to have a role in retrograde membrane traffic at the level of the Golgi complex. It may function in retrograde transport in neuronal cells.
Target Description: RAB6B seems to have a role in retrograde membrane traffic at the level of the Golgi complex. It may function in retrograde transport in neuronal cells.
Product Categories/Family for anti-RAB6B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
ras-related protein Rab-6B isoform 1
NCBI Official Synonym Full Names
RAB6B, member RAS oncogene family
NCBI Official Symbol
RAB6B
NCBI Protein Information
ras-related protein Rab-6B
UniProt Protein Name
Ras-related protein Rab-6B
Protein Family
UniProt Gene Name
RAB6B
UniProt Entry Name
RAB6B_HUMAN
Uniprot Description
RAB6B: Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells. Belongs to the small GTPase superfamily. Rab family.
Protein type: G protein, monomeric, Rab; G protein; G protein, monomeric
Chromosomal Location of Human Ortholog: 3q22.1
Cellular Component: Golgi membrane; Golgi apparatus; cytoplasmic membrane-bound vesicle
Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; myosin V binding
Biological Process: intra-Golgi vesicle-mediated transport; intracellular protein transport; metabolic process; retrograde vesicle-mediated transport, Golgi to ER; Rab protein signal transduction; retrograde transport, endosome to Golgi
Research Articles on RAB6B
Similar Products
Product Notes
The RAB6B rab6b (Catalog #AAA3219558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB6B Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB6B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB6B rab6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKTGYNVKQL FRRVASALPG MENVQEKSKE GMIDIKLDKP QEPPASEGGC. It is sometimes possible for the material contained within the vial of "RAB6B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
