Western Blot (WB)
(Host: RabbitTarget Name: Fyttd1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Fyttd1 Polyclonal Antibody | anti-FYTTD1 antibody
Fyttd1 Antibody - middle region
Gene Names
Fyttd1; Ac1176; RGD1306899
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fyttd1; Polyclonal Antibody; Fyttd1 Antibody - middle region; anti-FYTTD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD
Sequence Length
189
Applicable Applications for anti-FYTTD1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Fyttd1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Fyttd1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Fyttd1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FYTTD1 antibody
This is a rabbit polyclonal antibody against Fyttd1. It was validated on Western Blot
Target Description: Fyttd1 is required for mRNA export from the nucleus to the cytoplasm. It acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Fyttd1 associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.
Target Description: Fyttd1 is required for mRNA export from the nucleus to the cytoplasm. It acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Fyttd1 associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.
Product Categories/Family for anti-FYTTD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
UAP56-interacting factor
NCBI Official Synonym Full Names
forty-two-three domain containing 1
NCBI Official Symbol
Fyttd1
NCBI Official Synonym Symbols
Ac1176; RGD1306899
NCBI Protein Information
UAP56-interacting factor
UniProt Protein Name
UAP56-interacting factor
Protein Family
UniProt Gene Name
Fyttd1
UniProt Synonym Gene Names
Uif; Ac1176; Protein 40-2-3
UniProt Entry Name
UIF_RAT
Similar Products
FYTD1 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: ELISA, Western Blot, Immunohistochemistry
FYTD1 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, ELISA, Western Blot
Product Notes
The FYTTD1 fyttd1 (Catalog #AAA3214798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fyttd1 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fyttd1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FYTTD1 fyttd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEQLIDDVVA KRTRQTQKPR LTRTAVPSFL TKREQSDVKK IPKGVPLQFD. It is sometimes possible for the material contained within the vial of "Fyttd1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
