Western Blot (WB)
(Host: RabbitTarget Name: ZSCAN29Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit ZSCAN29 Polyclonal Antibody | anti-ZSCAN29 antibody
ZSCAN29 Antibody - C-terminal region
Gene Names
ZSCAN29; ZNF690; Zfp690
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZSCAN29; Polyclonal Antibody; ZSCAN29 Antibody - C-terminal region; anti-ZSCAN29 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHGEIHAREKLLTQSAP
Sequence Length
463
Applicable Applications for anti-ZSCAN29 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZSCAN29
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZSCAN29Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZSCAN29Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZSCAN29 antibody
This is a rabbit polyclonal antibody against ZSCAN29. It was validated on Western Blot
Target Description: ZSCAN29 may be involved in transcriptional regulation.
Target Description: ZSCAN29 may be involved in transcriptional regulation.
Product Categories/Family for anti-ZSCAN29 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 29
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 29
NCBI Official Symbol
ZSCAN29
NCBI Official Synonym Symbols
ZNF690; Zfp690
NCBI Protein Information
zinc finger and SCAN domain-containing protein 29
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 29
Protein Family
UniProt Gene Name
ZSCAN29
UniProt Synonym Gene Names
ZNF690
UniProt Entry Name
ZSC29_HUMAN
Similar Products
Product Notes
The ZSCAN29 zscan29 (Catalog #AAA3204903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN29 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN29 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZSCAN29 zscan29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSDLRAHHRT HTGEKPYGCH DCGKCFSKSS ALNKHGEIHA REKLLTQSAP. It is sometimes possible for the material contained within the vial of "ZSCAN29, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
