Western Blot (WB)
(Host: RabbitTarget Name: RBPJSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse RBPJ Polyclonal Antibody | anti-RBPJ antibody
RBPJ Antibody - middle region
Gene Names
Rbpj; CBF1; RBP-J; RBPjk; Igkjrb; Rbpsuh; Igkrsbp; AI843960; RBP-Jkappa; RBP-J kappa
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBPJ; Polyclonal Antibody; RBPJ Antibody - middle region; anti-RBPJ antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN
Sequence Length
487
Applicable Applications for anti-RBPJ antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse RBPJ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RBPJSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RBPJSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBPJ antibody
Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (By similarity). Negatively regulates the phagocyte oxidative burst in response to bacterial infection by repressing transcription of NADPH oxidase subunits.
Product Categories/Family for anti-RBPJ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
recombining binding protein suppressor of hairless isoform 2
NCBI Official Synonym Full Names
recombination signal binding protein for immunoglobulin kappa J region
NCBI Official Symbol
Rbpj
NCBI Official Synonym Symbols
CBF1; RBP-J; RBPjk; Igkjrb; Rbpsuh; Igkrsbp; AI843960; RBP-Jkappa; RBP-J kappa
NCBI Protein Information
recombining binding protein suppressor of hairless
UniProt Protein Name
Recombining binding protein suppressor of hairless
Protein Family
UniProt Gene Name
Rbpj
UniProt Synonym Gene Names
Igkjrb1; Igkrsbp; Rbpsuh
UniProt Entry Name
SUH_MOUSE
Research Articles on RBPJ
Similar Products
Product Notes
The RBPJ rbpj (Catalog #AAA3223642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBPJ Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBPJ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBPJ rbpj for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CVYLMGSGWK KKKEQMERDG CSEQESQPCA FIGIGNSDQE MQQLNLEGKN. It is sometimes possible for the material contained within the vial of "RBPJ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
