Western Blot (WB)
(WB Suggested Anti-PIP5KL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Rabbit PIP5KL1 Polyclonal Antibody | anti-PIP5KL1 antibody
PIP5KL1 antibody - middle region
Gene Names
PIP5KL1; PIPKH
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIP5KL1; Polyclonal Antibody; PIP5KL1 antibody - middle region; anti-PIP5KL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
Sequence Length
191
Applicable Applications for anti-PIP5KL1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 92%; Horse: 79%; Human: 100%; Pig: 85%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIP5KL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PIP5KL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-PIP5KL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-PIP5KL1 antibody
This is a rabbit polyclonal antibody against PIP5KL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
Target Description: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
Product Categories/Family for anti-PIP5KL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
phosphatidylinositol 4-phosphate 5-kinase-like protein 1 isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol-4-phosphate 5-kinase like 1
NCBI Official Symbol
PIP5KL1
NCBI Official Synonym Symbols
PIPKH
NCBI Protein Information
phosphatidylinositol 4-phosphate 5-kinase-like protein 1
UniProt Protein Name
Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
Protein Family
UniProt Gene Name
PIP5KL1
UniProt Synonym Gene Names
PI(4)P 5-kinase-like protein 1; PtdIns(4)P-5-kinase-like protein 1
UniProt Entry Name
PI5L1_HUMAN
NCBI Description
PIP5KL1 is a phosphoinositide kinase-like protein that lacks intrinsic lipid kinase activity but associates with type I PIPKs (see PIP5K1A; MIM 603275) and may play a role in localization of PIPK activity (Chang et al., 2004 [PubMed 14701839]).[supplied by OMIM, Jun 2009]
Uniprot Description
PIP5KL1: May act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Motility/polarity/chemotaxis; Kinase, lipid; EC 2.7.1.68
Chromosomal Location of Human Ortholog: 9q34.11
Cellular Component: cell projection; membrane; cytoplasm
Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity; ATP binding
Biological Process: phosphoinositide phosphorylation
Research Articles on PIP5KL1
Similar Products
Product Notes
The PIP5KL1 pip5kl1 (Catalog #AAA3211215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIP5KL1 antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PIP5KL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIP5KL1 pip5kl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLDYSLLIAF QRLHEDERGP GSSLIFRTAR SVQGAQSPEE SRAQNRRLLP. It is sometimes possible for the material contained within the vial of "PIP5KL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
