Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CEP55 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCEP55 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit CEP55 Polyclonal Antibody | anti-CEP55 antibody

CEP55 antibody - N-terminal region

Gene Names
CEP55; CT111; MARCH; URCC6; C10orf3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEP55; Polyclonal Antibody; CEP55 antibody - N-terminal region; anti-CEP55 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
Sequence Length
464
Applicable Applications for anti-CEP55 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Pig: 92%; Rabbit: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CEP55
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CEP55 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCEP55 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-CEP55 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateCEP55 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-CEP55 antibody
This is a rabbit polyclonal antibody against CEP55. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Product Categories/Family for anti-CEP55 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
centrosomal protein of 55 kDa
NCBI Official Synonym Full Names
centrosomal protein 55
NCBI Official Symbol
CEP55
NCBI Official Synonym Symbols
CT111; MARCH; URCC6; C10orf3
NCBI Protein Information
centrosomal protein of 55 kDa
UniProt Protein Name
Centrosomal protein of 55 kDa
Protein Family
UniProt Gene Name
CEP55
UniProt Synonym Gene Names
C10orf3; URCC6; Cep55
UniProt Entry Name
CEP55_HUMAN

Uniprot Description

CEP55: Plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation. Recruits PDCD6IP and TSG101 to midbody during cytokinesis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Cell cycle regulation

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: centriole; centrosome; intercellular bridge; membrane; midbody; cleavage furrow

Molecular Function: protein binding

Biological Process: establishment of protein localization; cell separation during cytokinesis; cytokinesis after mitosis; mitotic metaphase plate congression; nuclear organization and biogenesis

Research Articles on CEP55

Similar Products

Product Notes

The CEP55 cep55 (Catalog #AAA3208141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEP55 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CEP55 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEP55 cep55 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSRSTKDLI KSKWGSKPSN SKSETTLEKL KGEIAHLKTS VDEITSGKGK. It is sometimes possible for the material contained within the vial of "CEP55, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.