Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FAM29A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Rabbit FAM29A Polyclonal Antibody | anti-HAUS6 antibody

FAM29A antibody - middle region

Gene Names
HAUS6; Dgt6; FAM29A
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM29A; Polyclonal Antibody; FAM29A antibody - middle region; anti-HAUS6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT
Sequence Length
955
Applicable Applications for anti-HAUS6 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM29A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FAM29A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-FAM29A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-HAUS6 antibody
This is a rabbit polyclonal antibody against FAM29A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.
Product Categories/Family for anti-HAUS6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
HAUS augmin-like complex subunit 6 isoform 1
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 6
NCBI Official Symbol
HAUS6
NCBI Official Synonym Symbols
Dgt6; FAM29A
NCBI Protein Information
HAUS augmin-like complex subunit 6
UniProt Protein Name
HAUS augmin-like complex subunit 6
Protein Family
UniProt Gene Name
HAUS6
UniProt Synonym Gene Names
DGT6; FAM29A; KIAA1574
UniProt Entry Name
HAUS6_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. This protein may have a role in efficient chromosome congression and segregation by promoting microtubule-dependent microtubule amplification. Pseudogenes of this gene are located on chromosomes 7 and 20. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]

Uniprot Description

HAUS6: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin. Belongs to the HAUS6 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 9p22.1

Cellular Component: nucleoplasm; microtubule; centrosome; cytoplasm; microtubule organizing center; spindle

Biological Process: mitosis; cell division; centrosome organization and biogenesis; spindle assembly

Research Articles on HAUS6

Similar Products

Product Notes

The HAUS6 haus6 (Catalog #AAA3213120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM29A antibody - middle region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FAM29A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAUS6 haus6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSLSPLIKFS PVEQRLRTTI ACSLGELPNL KEEDILNKSL DAKEPPSDLT. It is sometimes possible for the material contained within the vial of "FAM29A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.