Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ITGB1BP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Rabbit ITGB1BP3 Polyclonal Antibody | anti-NMRK2 antibody

ITGB1BP3 antibody - middle region

Gene Names
NMRK2; MIBP; NRK2; ITGB1BP3
Reactivity
Cow, Horse, Human, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGB1BP3; Polyclonal Antibody; ITGB1BP3 antibody - middle region; anti-NMRK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
Sequence Length
230
Applicable Applications for anti-NMRK2 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ITGB1BP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ITGB1BP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-ITGB1BP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Related Product Information for anti-NMRK2 antibody
This is a rabbit polyclonal antibody against ITGB1BP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to lami
Product Categories/Family for anti-NMRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
nicotinamide riboside kinase 2 isoform 2
NCBI Official Synonym Full Names
nicotinamide riboside kinase 2
NCBI Official Symbol
NMRK2
NCBI Official Synonym Symbols
MIBP; NRK2; ITGB1BP3
NCBI Protein Information
nicotinamide riboside kinase 2
UniProt Protein Name
Nicotinamide riboside kinase 2
UniProt Gene Name
NMRK2
UniProt Synonym Gene Names
ITGB1BP3; NRK2; NRK 2; NmR-K 2; MIBP; RNK 2
UniProt Entry Name
NRK2_HUMAN

Uniprot Description

ITGB1BP3: an enzyme that catalyzes the phosphorylation of nicotinamide riboside and nicotinic acid riboside to form nicotinamide mononucleotide and nicotinic acid mononucleotide. Reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin. Interacts with ITGB1 alone or when associated with alpha-7, but not with alpha-5. Involved in the regulation of PXN at the protein level and of PXN tyrosine phosphorylation. Predominantly expressed in skeletal muscle and, at a much lower level, in the heart (at protein level). No expression in brain, kidney, liver, lung, pancreas nor placenta. May play a role in the regulation of terminal myogenesis. Two alternatively spliced human isoforms have been described.

Protein type: EC 2.7.1.22; Cell adhesion; EC 2.7.1.173; Cell development/differentiation; Kinase, other

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: intracellular

Molecular Function: protein binding; ribosylnicotinamide kinase activity; metal ion binding; ATP binding

Biological Process: NAD biosynthetic process; negative regulation of myoblast differentiation; phosphorylation

Similar Products

Product Notes

The NMRK2 nmrk2 (Catalog #AAA3206521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB1BP3 antibody - middle region reacts with Cow, Horse, Human, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB1BP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMRK2 nmrk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKPLVDLYSR RYFLTVPYEE CKWRRSTRNY TVPDPPGLFD GHVWPMYQKY. It is sometimes possible for the material contained within the vial of "ITGB1BP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.